KEGG   Pseudomonas aeruginosa NCGM 1900: NCGM1900_0870Help
Entry
NCGM1900_0870     CDS       T03789                                 

Definition
(GenBank) hypothetical protein
  KO
K09956  uncharacterized protein
Organism
paeb  Pseudomonas aeruginosa NCGM 1900
Brite
KEGG Orthology (KO) [BR:paeb00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    NCGM1900_0870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2218 Phage_GPD
Motif
Other DBs
NCBI-ProteinID: BAP19994
UniProt: A0A072ZCR3
LinkDB All DBs
Structure
PDB: 

Position
complement(916597..916887)
Genome map
AA seq 96 aa AA seqDB search
MFRSTSHVRTESAARYVNRLCKHWGHKFEVELTPERGFIDFGDSNCELLAHPDHVLMILN
SPDEDSLAHMQNVVADHLQRMANSESLEIAWQPAES
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgttccgctccacctcccatgtccgtaccgaatcggccgcacgctacgtcaatcgcctg
tgcaagcactggggccacaagttcgaagtcgaactcactcccgagcgcggcttcatcgac
ttcggcgactccaactgcgagctgctcgcccaccccgaccatgtcctgatgattctcaac
agccccgacgaggacagcctcgcccatatgcagaacgtggtcgccgatcacctgcaacgc
atggccaacagcgaaagcctggagattgcctggcagcccgccgaaagctga

DBGET integrated database retrieval system