KEGG   Pseudomonas aeruginosa NCGM 1900: NCGM1900_1576Help
Entry
NCGM1900_1576     CDS       T03789                                 

Gene name
yfcG
Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
paeb  Pseudomonas aeruginosa NCGM 1900
Brite
KEGG Orthology (KO) [BR:paeb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NCGM1900_1576 (yfcG)
Enzymes [BR:paeb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     NCGM1900_1576 (yfcG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_3 GST_C_2 Helicase_C_3
Motif
Other DBs
NCBI-ProteinID: BAP20698
UniProt: A0A072ZMU4
LinkDB All DBs
Position
1612957..1613598
Genome map
AA seq 213 aa AA seqDB search
MIDLYYWTTPNGHKITLFLEETGLPYAIHPINISQGDQFQADFLKVSPNNKIPAIVDRQP
ADGGAPLSLFESGAILLYLAEKTGRFLAKDLRARQETLQWLFWQMGGLGPMAGQNHHFNR
FAPEKIPYAIDRYVKETARLYGVLDQRLADRAFVAGDDYSIADMAIYPWIVPHQWQEQDL
ADFPHLQRWFESIRQRPATQRAYALVERINPPQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctgtactactggaccaccccgaacggccacaagattactcttttcctggaa
gaaaccggcctgccctacgccatccatccgatcaacatcagccagggcgaccagttccag
gcggatttcctgaaggtgtcgccgaacaacaagattcccgccatcgtcgatcgccaacca
gccgacggcggcgctcccctgtcgctgttcgagtccggcgccatcctgctctatctcgcg
gaaaagaccggacggttcctcgccaaggacctgcgcgcgcgccaggaaaccctgcagtgg
ctgttctggcagatgggcgggctggggccgatggccgggcagaaccaccatttcaaccgc
ttcgccccggagaagattccctacgccatcgaccgttacgtcaaggaaaccgcgcgcctg
tacggcgttctcgaccagcgcctggcggaccgcgccttcgtcgccggcgacgactacagc
atcgccgacatggccatctatccgtggatcgtcccacatcagtggcaggagcaggatctc
gccgacttcccacacctgcagcgctggttcgagagcattcgccagcgtccggcgacgcaa
cgcgcctatgctttggtggagcgcatcaatccgccgcagtag

DBGET integrated database retrieval system