KEGG   Pseudomonas aeruginosa NCGM 1900: NCGM1900_1765Help
Entry
NCGM1900_1765     CDS       T03789                                 

Gene name
rbn
Definition
(GenBank) ribonuclease
  KO
K07058  membrane protein
Organism
paeb  Pseudomonas aeruginosa NCGM 1900
Brite
KEGG Orthology (KO) [BR:paeb00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    NCGM1900_1765 (rbn)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB AGH
Motif
Other DBs
NCBI-ProteinID: BAP20882
UniProt: A0A4V8DU50
LinkDB All DBs
Position
complement(1823156..1824391)
Genome map
AA seq 411 aa AA seqDB search
MREHFNDGVEFARFLAHRFVTDKAPNSAAALTYTTLFAVVPMMTVMFSMLSLIPAFHGMG
ESIQTFIFRNFVPSAGEAVETYLKSFTTQARHLTWVGVVFLAVTAFTMLVTIEKAFNEIW
RVRQPRRGVGRFLLYWAILSLGPLLLGAGFAVTTYITSLSLLHGPDALPGAETLLGLMPL
AFSVAAFTLLYSAVPNARVPVRHALMGGVFTAVLFEAAKTLFGLYVSLFPGYQLIYGAFA
TVPIFLLWIYLSWMIVLFGAVLVCNLSSSRLWRRRSLPKLIVLLGVLRVFHQRQQLGQSL
RLTHLHRAGWLLPEDEWEELLDFLEKEQFVCRAGGGEWVLCRDLGAYSVHRLLNRCPWPM
PSRERMPANLDEAWYPPFQQAMERLQVEQEALFGESLAHWLADGTSGAKVT
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaacatttcaacgatggggtcgagttcgctcgcttcctcgctcatcgcttcgtc
accgacaaggctcccaacagcgcggcggcgctgacctacaccacgttgttcgcggtagtg
ccgatgatgacggtgatgttttccatgctttcgctgattccggcattccatggcatgggc
gagtcgatccagactttcatctttcgcaatttcgtgccttccgctggagaagcggtggaa
acctacctgaagagtttcaccacccaggcccggcacctgacctgggtcggggtggtcttt
ctggcagtcaccgccttcaccatgctggtgaccatcgagaaagccttcaacgagatctgg
cgggttcgccagccacgccggggtgtcgggcggttcctcctctactgggcgatcctcagc
ctgggcccattgttgctgggggccggcttcgccgtgaccacctacatcacttcgctgtcg
ctgctccatggcccggacgcgttgccgggcgcggagacgctgctagggctgatgccgctg
gcgttcagcgtggcggccttcaccctgctctattcggcggtcccgaacgcccgggtcccg
gtgcgccatgccctgatgggcggcgtgttcaccgcggtactgttcgaagccgcgaaaacc
ctgttcgggctgtacgtaagcctgtttcccggctaccagttgatctacggtgccttcgcc
accgtgcctatcttcctgctgtggatctatctttcctggatgatcgttctgttcggcgcg
gtgctggtctgcaatctctcttcttcccgtctctggcggcggcgctcgctgcccaagctg
atcgttctgctcggcgtgctgagggtgttccaccagcgccagcagcttggacagtcgcta
cgcctgacccacttgcatcgtgcgggttggctgttgcccgaggatgagtgggaggaactg
ctggactttctcgagaaggagcagttcgtctgccgcgccggcggaggtgagtgggtgctg
tgccgggatcttggcgcctacagtgtgcaccgcttgctgaatcgctgcccctggcccatg
cctagccgagagcgcatgcctgcgaatctggacgaggcgtggtatccgccgttccagcag
gccatggagcgcttgcaggtggagcaggaggcgctgttcggagaaagcctggcccactgg
ctggcggacggaacctcgggagcgaaggtgacgtaa

DBGET integrated database retrieval system