KEGG   Pseudomonas aeruginosa NCGM 1900: NCGM1900_2195Help
Entry
NCGM1900_2195     CDS       T03789                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
paeb  Pseudomonas aeruginosa NCGM 1900
Brite
Enzymes [BR:paeb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NCGM1900_2195 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAP21302
UniProt: A0A072ZEC2
LinkDB All DBs
Position
2268604..2269185
Genome map
AA seq 193 aa AA seqDB search
MAFELPPLPYEKNALEPHISAETLEYHHDKHHNTYVVNLNNLIPGTEFEGKSLEEIVKSS
SGGIFNNAAQVWNHTFYWNCLSPNGGGQPTGALADAINAAFGSFDKFKEEFTKTSVGTFG
SGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN
LVNWDFVAKNFAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgccgccgctgccttacgaaaagaacgcccttgagccgcacatttcc
gcagaaaccctggaataccaccacgacaagcaccacaacacctacgtggtgaacctgaac
aacctgatcccgggcaccgagttcgaaggcaagagcctcgaagagatcgtcaagagctcc
tccggcggcatcttcaacaacgccgcccaggtgtggaaccacaccttctactggaactgc
ctgagcccgaacggcggtggccagcccaccggcgccctggccgacgccatcaacgccgcc
ttcggctccttcgacaagttcaaggaagagttcaccaagacttccgtcggcaccttcggt
tccggctggggctggctggtgaagaaggccgacggctccctggccctggccagcaccatc
ggtgccggcaacccgctgaccagcggcgacaccccgctgctgacctgcgacgtgtgggaa
cacgcctactacatagactaccgcaacctgcgtccgaagtacgtcgaggcgttctggaac
ctggtcaactgggacttcgtagcgaagaatttcgctgcctga

DBGET integrated database retrieval system