KEGG   Pseudomonas aeruginosa NCGM 1900: NCGM1900_3291Help
Entry
NCGM1900_3291     CDS       T03789                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
paeb  Pseudomonas aeruginosa NCGM 1900
Pathway
paeb00071  Fatty acid degradation
paeb00280  Valine, leucine and isoleucine degradation
paeb00281  Geraniol degradation
paeb00310  Lysine degradation
paeb00362  Benzoate degradation
paeb00380  Tryptophan metabolism
paeb00410  beta-Alanine metabolism
paeb00640  Propanoate metabolism
paeb00650  Butanoate metabolism
paeb00903  Limonene and pinene degradation
paeb00930  Caprolactam degradation
paeb01100  Metabolic pathways
paeb01110  Biosynthesis of secondary metabolites
paeb01120  Microbial metabolism in diverse environments
paeb01130  Biosynthesis of antibiotics
paeb01200  Carbon metabolism
paeb01212  Fatty acid metabolism
Module
paeb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:paeb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NCGM1900_3291 (fadB)
   00650 Butanoate metabolism
    NCGM1900_3291 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NCGM1900_3291 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NCGM1900_3291 (fadB)
   00310 Lysine degradation
    NCGM1900_3291 (fadB)
   00380 Tryptophan metabolism
    NCGM1900_3291 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NCGM1900_3291 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    NCGM1900_3291 (fadB)
   00281 Geraniol degradation
    NCGM1900_3291 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NCGM1900_3291 (fadB)
   00930 Caprolactam degradation
    NCGM1900_3291 (fadB)
Enzymes [BR:paeb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     NCGM1900_3291 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     NCGM1900_3291 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     NCGM1900_3291 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     NCGM1900_3291 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: BAP22381
UniProt: A0A069QB72
LinkDB All DBs
Position
3434902..3437049
Genome map
AA seq 715 aa AA seqDB search
MIYQGKAITVKPLEGGIVELNFDLKGESVNKFNRLTLSELRAAVDAIKADASVKGVIVTS
GKDVFIVGADITEFVDNFQLPDEELMAGNLEANKIFSDFEDLDVPTVAAINGIALGGGLE
MCLAADFRVMSATAKVGLPEVKLGIYPGFGGTVRLPRLIGCDNAVEWIASGKENKAEDAL
KVGAVDAVVAPEQLQAAALDLAKRAVAGELDHKARRQPKLEKLKLNAIEQMMAFETAKGF
VAGQAGPNYPAPVEAIKSIQKAANFGRDKALEVEAAGFVKLAKTSVAQSLIGLFLNDQEL
KKKAKKYDEVAKDVKLAAVLGAGIMGGGIAYQSALKGTPILMKDIREEGIQMGLNEAAKL
LGKRVEKGRLTPAKMAEALNGIRPTMSYGDFGNVDIVVEAVVENPKVKQAVLAEVEGAVK
EDAIIASNTSTISISLLAQALKRPENFCGMHFFNPVHMMPLVEVIRGEKTGETAIATTVA
YAKKMGKSPIVVNDCPGFLVNRVLFPYFGGFAKLLSFGVDFVRIDKVMEKFGWPMGPAYL
SDVVGIDTGHHGRDVMAEGFPDRMAVEGKTAVDVMYEANRLGQKNGKGFYAYETDKRGKP
KKVTDPQAYEVLKPIVVEQREVTDEDIVNFMMIPLCLETVRCLEDGIVETAAEADMGLIY
GIGFPPFRGGALRYIDSIGVAEFVALADKYAELGALYHPTAKLREMAKNGQKFFG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaaggtaaagccatcacggttaagcctcttgagggcggcatcgtcgagttg
aatttcgatctcaagggcgagtccgtcaacaagttcaaccgtctcaccctcagtgagttg
cgtgcggcagtcgatgcgatcaaggccgatgcatcggtcaagggcgtgatcgtgaccagc
ggcaaggacgtgttcatcgttggtgccgacatcaccgagttcgttgacaacttccagctg
cccgacgaggaactgatggcgggcaacctcgaagccaacaagatcttcagcgacttcgaa
gacctggacgtacccaccgttgccgcgatcaacggcatcgccctcggcggcggcctggag
atgtgcctggccgcggacttccgcgtgatgagcgcgaccgccaaggtcggcctgccggaa
gtcaagctgggcatctacccgggcttcggcggcaccgtccgcctgccgcgcctgatcggc
tgcgataacgccgtcgagtggatcgcctcgggcaaggaaaacaaggccgaggacgccctg
aaggtcggcgccgtcgacgccgtggttgctcccgagcaactgcaggccgctgccctcgac
ctggccaagcgcgccgtcgccggcgagctggaccacaaggcacggcgccagccgaagctg
gaaaagctgaagctgaatgcaatcgagcagatgatggccttcgaaaccgccaagggcttc
gtcgccggccaggccggtccgaactacccggcgccggtggaagccatcaagagcatccag
aaggccgccaacttcggccgcgacaaggcgctggaagtcgaagccgccggcttcgtcaag
ctggccaagacctcggttgcgcagagcctgatcggcctgttcctgaatgaccaggaactg
aagaagaaagccaagaaatacgacgaagtcgccaaggacgtgaaactggccgccgtgctc
ggcgccggcatcatgggcggcggcatcgcctatcagtcggcgctcaagggcaccccgatc
ctgatgaaggatatccgcgaagagggtatccagatgggcctgaacgaggccgccaagctg
ctcggcaagcgcgtcgagaagggtcgcctgaccccggcgaagatggccgaggcgctcaat
ggcatccgtccgaccatgtcctatggcgacttcggcaacgtcgacatcgtcgtcgaagcc
gtcgtcgagaaccccaaggtcaagcaagccgtgctcgccgaagtggaaggcgcggtgaag
gaagacgcgatcatcgcctccaacacctcgaccatctccatcagcctgctggcccaggcg
ctgaagcgtccggaaaacttctgcggcatgcatttcttcaacccggtgcacatgatgccg
ctggtggaagtgatccgtggcgagaagaccggtgaaaccgccatcgccaccaccgtcgcc
tacgccaagaagatgggcaagagcccgatcgtggtcaacgattgccccggcttcctggtc
aaccgcgtgctgttcccgtacttcggcggcttcgccaagctgctgagcttcggcgtcgac
ttcgtgcgcatcgacaaggtgatggagaagttcggctggcccatgggcccggcctacctg
tccgacgtggtcggcatcgacaccggccaccatggccgcgacgtcatggccgagggcttc
ccggaccgcatggcggtcgagggcaagaccgccgtcgacgtgatgtacgaggccaaccgc
ctgggccagaagaacggcaagggcttctacgcctacgagaccgacaagcgcggcaagccg
aagaaggtcaccgatccgcaggcctacgaagtgctcaagccgatcgtggtcgagcagcgc
gaagtgaccgacgaggacatcgtcaacttcatgatgatcccgctgtgcctggaaaccgtg
cgttgcctggaagacggcatcgtcgagaccgctgccgaggccgatatgggcctgatctac
ggcatcggcttcccgcccttccgtggtggtgctctgcgctacatcgattcgatcggtgtc
gccgagttcgtggccctggccgacaagtacgccgagctgggcgcgctgtaccacccgacc
gcgaagctgcgtgaaatggccaagaacggtcagaaattcttcggttaa

DBGET integrated database retrieval system