KEGG   Pseudomonas aeruginosa NCGM 1900: NCGM1900_3496Help
Entry
NCGM1900_3496     CDS       T03789                                 

Definition
(GenBank) putative glutathione S-transferase
Organism
paeb  Pseudomonas aeruginosa NCGM 1900
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 GST_N_4 Tom37
Motif
Other DBs
NCBI-ProteinID: BAP22585
LinkDB All DBs
Position
complement(3637563..3638225)
Genome map
AA seq 220 aa AA seqDB search
MSLTLYGAPLSPFVRKVRLLLAEKGLDYQLEAIAPFGQPAWYREISPLGRIPALRDGDLA
LADSSVICQYLEERYPEPPNLQGDAPAGRAAVRWLEKYADYEIAPLATLTIFRNRILKPA
MGQACEENDVRRALEEKLPAHFDYLENHLDGRAFFVGERLTLADLAIASQLVNLRHAGEN
LDEQRWPALAVHFARMLERPAMQALLPGERRTLDKLAAKA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgacactctacggagccccgctgtctccgttcgtccgcaaggtccgcctgctc
ctggccgaaaagggcctcgactaccagttggaagcgatcgccccgttcggccagccggcc
tggtatcgcgagatcagtccgctgggccgcatcccggcgttacgcgacggcgacctggcc
ctcgccgactccagcgtgatctgccagtacctggaagaacgctatcccgaaccgccgaat
ctccagggcgacgcccccgccggccgcgcagcggtgcgctggctggaaaaatacgccgac
tacgagatcgctcccctggccacgctgacgatcttccgcaaccggatactcaagccggcg
atgggccaggcctgcgaggagaacgacgtgcgtcgcgcgctggaggaaaagctgccagcg
cacttcgattacctggaaaaccatctcgacggccgggccttcttcgtcggcgagcgactg
accctcgccgacctggcgatcgccagccagttggtcaacctgcgtcacgccggcgaaaac
ctggacgagcaacgctggccggccctcgccgtgcatttcgcgcggatgctcgaacgcccg
gcgatgcaagcgctgctgccgggggaacgacggaccctcgacaagctcgcagcgaaagcc
tga

DBGET integrated database retrieval system