KEGG   Pseudomonas aeruginosa NCGM 1900: NCGM1900_5101Help
Entry
NCGM1900_5101     CDS       T03789                                 

Definition
(GenBank) hypothetical protein
Organism
paeb  Pseudomonas aeruginosa NCGM 1900
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAP24173
UniProt: A0A072ZL64
LinkDB All DBs
Position
complement(5400498..5400914)
Genome map
AA seq 138 aa AA seqDB search
MKAKYLGLAILLGGLGGCVVHPPQTSEPPASLPPQSQPQPGPSSAPGATPPRITPQPQTP
AQPSRSRPQFAPPPGGKGVWDGSLGVYVIRGERDLYYRQRTYYRWDGGWFWSTSPQGPWT
ETDARGIPPGLSRRYANP
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggcgaagtatctgggtctggcgattctcctgggcggtctcggcgggtgcgtggtg
catccgccgcagaccagcgaaccgccggcctcgctgccgccgcaaagccagccgcagccc
ggtccgtccagcgcgcccggcgccaccccgccgcgcatcaccccgcaaccgcagactccg
gcgcagcccagccgctcgcgtccgcagttcgccccgccgccaggcggcaagggcgtctgg
gacggcagcctgggggtctatgtgatccgcggcgagcgcgatctctactaccgccagcgt
acctactaccgctgggacggcggctggttctggtccaccagcccgcagggtccctggacc
gagaccgacgcccgcggcatcccgcccggtctcagccggcgctacgccaatccatga

DBGET integrated database retrieval system