KEGG   Pseudomonas aeruginosa NCGM 1900: NCGM1900_5429Help
Entry
NCGM1900_5429     CDS       T03789                                 

Gene name
mrcB
Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
paeb  Pseudomonas aeruginosa NCGM 1900
Pathway
paeb00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:paeb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NCGM1900_5429 (mrcB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:paeb01003]
    NCGM1900_5429 (mrcB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:paeb01011]
    NCGM1900_5429 (mrcB)
Enzymes [BR:paeb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     NCGM1900_5429 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     NCGM1900_5429 (mrcB)
Glycosyltransferases [BR:paeb01003]
 Polysaccharide
  Bacterial polysaccharide
   NCGM1900_5429 (mrcB)
Peptidoglycan biosynthesis and degradation proteins [BR:paeb01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   NCGM1900_5429 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase UvrB_inter
Motif
Other DBs
NCBI-ProteinID: BAP24494
LinkDB All DBs
Position
complement(5732174..5734393)
Genome map
AA seq 739 aa AA seqDB search
MLLAGFAIYLDAVVQEKFSGRRWTIPAKVYARPLELFNGLKLSREDFLRELDALGYRREP
SVSGPGTVSVAASAVELNTRGFQFYEGAEPAQRVRVRFNGNYVSGLSQANGKELAVARLE
PLLIGGLYPAHHEDRILVKLDQVPTYLIDTLVAVEDRDFWNHHGVSLKSVARAVWVNTTA
GQLRQGGSTLTQQLVKNFFLSNERSLSRKINEAMMAVLLELHYDKRDILESYLNEVFLGQ
DGQRAIHGFGLASQYFFSQPLAELKLDQVALLVGMVKGPSYFNPRRYPDRALARRNLVLD
VLAEQGVATQQEVDAAKQRPLGVTRQGSMADSSYPAFLDLVKRQLRQDYRDEDLTEEGLR
IFTSFDPILQEKAETSVNETLKRLSGRKGVDQVEAAMVVTNPETGEIQALIGSRDPRFAG
FNRALDAVRPIGSLIKPAVYLTALERPSKYTLTTWVQDEPFAVKGQDGQVWRPQNYDRRS
HGTIFLYQGLANSYNLSTAKLGLDVGVPNVLQTVARLGINRDWPAYPSMLLGAGSLSPME
VATMYQTIASGGFNTPLRGIRSVLTADGQPLKRYPFQVEQRFDSGAVYLVQNAMQRVMRE
GTGRSVYSQLPSSLTLAGKTGTSNDSRDSWFSGFGGDLQAVVWLGRDDNGKTPLTGATGA
LQVWASFMRKAHPQSLEMPMPENVVMAWVDAQTGQGSAADCPNAVQMPYIRGSEPAQGPG
CGSQNPAGEVMDWVRGWLN
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgctcctcgccggcttcgccatctatctcgatgccgtggtgcaggagaaattctccggc
cggcgctggaccatcccggcgaaggtctatgcccgcccgctggagctgttcaacggcctg
aagctgagcagggaagacttcctgcgcgaactcgacgccctcggctaccgtcgcgagccc
agcgtgagcggccctggaaccgtatcggtggcggccagcgcggtcgaactcaatacccgt
ggcttccagttctacgaaggcgcggaaccggcccagcgcgtgcgcgtgcgcttcaacggc
aactatgtcagcgggctgagccaggccaacggcaaggaactggcggtggcgcgccttgag
ccgctgctgatcggcggcttgtatccggcgcaccatgaggatcgcatcctggtcaagctc
gaccaggtgccgacctacctgatcgacaccctggtcgcggtcgaggatcgcgacttctgg
aaccaccatggcgtgtcgctgaaatccgtggcccgggcggtgtgggtcaacaccacggcc
ggccagctgcgccagggcggcagcaccctgacccagcagttggtgaagaacttcttcctg
agcaatgagcgcagcctgagccgcaagatcaatgaagcgatgatggcggtgctgctggaa
ctgcactacgacaagcgcgacatcctcgagtcctatctcaacgaggtgttcctcggccag
gatgggcaacgagcgatccatggcttcggcctggccagccagtatttcttcagccagccg
ctggccgagctcaagctcgaccaggtggcgctgctggtcggcatggtcaagggaccgtcc
tacttcaacccgcggcgttacccggatcgtgcgctggcgcggcgcaacctggtgctcgac
gtgctcgccgagcagggcgtggcgacccagcaggaagtcgacgccgccaagcagcgcccg
ctcggcgttacccggcagggcagcatggccgacagctcctatccggccttcctcgacctg
gtcaagcgccagttgcgccaggactaccgcgacgaggacctgaccgaggaagggctgcgc
atcttcaccagcttcgatccgatcctgcaggagaaggccgagacctctgtcaacgaaacg
ctcaagcgcctcagtgggcgcaagggagtcgaccaggtcgaggcggcgatggtcgtgacc
aatccggaaaccggcgagatccaggccctgatcggcagtcgcgacccgcgcttcgccggc
ttcaaccgggccctggacgcggtgcggccgatcggttcgctgatcaagccggcggtctac
ctgaccgctctcgagcggccgagcaagtacaccctgaccacctgggtgcaggacgagccc
ttcgcggtgaaaggccaggacggccaggtctggcgaccgcagaactacgaccggcgctcg
catggcacgatcttcctgtaccagggcctggcaaactcctacaacctgtccaccgccaag
ctcggcctcgacgtcggtgtgcccaacgtgctgcagaccgtcgcccggctgggtatcaac
cgtgactggccggcctatccgtcgatgctgctgggcgccggttcgctcagtccgatggag
gtcgccaccatgtaccagaccatcgccagcggcggcttcaacacgccgttgcgggggatc
cgcagcgtcctcactgccgacggccagccgctcaagcgctatccgttccaggtcgaacag
cgcttcgactcgggcgccgtctacctggtgcagaacgccatgcagcgggtcatgcgcgaa
ggcaccgggcgttcggtgtacagtcaattgccgtcgtcgctgaccctcgccggcaagacc
ggcaccagcaacgactcgcgcgatagctggttctccggtttcggcggcgacctccaggct
gtggtctggctcggtcgcgacgacaacggcaagacgccgcttaccggcgccaccggtgcc
ttgcaggtgtgggccagcttcatgcgcaaggcgcatccgcaatcgctggaaatgccgatg
ccggagaacgtggtgatggcctgggtcgacgcgcagaccgggcagggctcggcggcggat
tgcccgaatgccgtacagatgccctatattcgtggcagcgagcccgcccagggcccaggc
tgcgggagccagaaccccgccggcgaggtgatggactgggtacgtggctggctgaattga

DBGET integrated database retrieval system