KEGG   Pseudomonas aeruginosa c7447m: M802_2927Help
Entry
M802_2927         CDS       T03098                                 

Definition
(GenBank) hypothetical protein
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
paec  Pseudomonas aeruginosa c7447m
Pathway
paec00290  Valine, leucine and isoleucine biosynthesis
paec01100  Metabolic pathways
paec01110  Biosynthesis of secondary metabolites
paec01130  Biosynthesis of antibiotics
paec01210  2-Oxocarboxylic acid metabolism
paec01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:paec00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M802_2927
   00290 Valine, leucine and isoleucine biosynthesis
    M802_2927
   00220 Arginine biosynthesis
    M802_2927
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:paec01007]
    M802_2927
Enzymes [BR:paec01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     M802_2927
    2.6.1.66  valine---pyruvate transaminase
     M802_2927
Amino acid related enzymes [BR:paec01007]
 Aminotransferase (transaminase)
  Class I
   M802_2927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGV67383
LinkDB All DBs
Position
3179566..3180777
Genome map
AA seq 403 aa AA seqDB search
MQVSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPEEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYYQQKQVEGVGIEDIYLGNGVSELIVMSMQALLNNGDE
VLIPAPDYPLWTAAVSLAGGKPVHYLCDEQANWWPDLEDIKAKITPNTRAMVIINPNNPT
GAVYSREVLEGMVELARQHNLVLFSDEIYDKILYDGAVHVSTASLAPDVLCLTFNGLSKS
YRVAGFRSGWVAISGPKQRAQSYIEGLDILANMRLCANVPAQHAIQTALGGYQSINDLVL
PPGRLLEQRNRAWELLNDIPGVSCVKPMGALYAFPRIDPKVCPIHNDEKFVLDLLLSEKL
LIVQGTAFNWPWPDHFRVVTLPRVDDLEQAILRIGSFLKGYQQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcagcaaatcgaacaagctcgccaacgtctgctatgacattcgcgggccggtg
ctcaagcacgccaaacgcctagaggaagagggtcaccgcatcctcaagctgaatatcggc
aacccggcgccgttcggtttcgaagctcccgaggaaattctccaggacgtcatccgcaac
ctgccgaccgcccagggctacagcgactccaagggcctgttcagcgcgcgcaaggcagtg
atgcagtattaccagcagaagcaggtggaaggcgtcggcatcgaggacatctacctcggc
aacggcgtgtcggaactgatcgtgatgtccatgcaggcgctgctgaacaacggcgacgag
gtgctgatccccgctcccgactacccgctgtggaccgccgccgtcagcctcgccggcggc
aagccggtgcactacctgtgcgacgagcaggccaactggtggccggacctggaagacatc
aaggcgaagatcacgccgaataccagggcgatggtgatcatcaacccgaacaaccccacc
ggcgcggtgtattccagggaagtgctggaaggcatggtcgaactggcccgccagcacaac
ctggtgctgttctccgacgagatctacgacaagatcctctacgacggcgccgtccacgtc
tccaccgcctcgctggcgccggacgtgctctgcctgaccttcaacggcctgtccaaatcc
taccgggtggccggcttccgctccggctgggtggcgatctccgggcccaagcagcgggcg
cagagctatatcgaaggtctcgacatcctcgccaacatgcgcctgtgcgccaacgtcccg
gcgcagcacgcgatccagaccgccctgggcggctaccagagcatcaacgatctggtcctg
ccgccggggcgcctgctggagcagcgcaaccgcgcctgggaactgctcaacgacatcccc
ggcgtcagctgcgtgaagccgatgggcgcgctgtacgccttcccgcggatcgatccgaag
gtctgcccgatccacaacgacgaaaagttcgtcctcgacctgctgctctcggaaaaactg
ctgatcgtccagggcaccgccttcaactggccgtggcccgaccacttccgggtggtcacc
ctgccccgcgtcgacgacctggagcaggcgatcctgcgcatcggcagcttcctcaagggc
taccagcagtaa

DBGET integrated database retrieval system