KEGG   Pseudomonas aeruginosa c7447m: M802_2927Help
Entry
M802_2927         CDS       T03098                                 

Definition
(GenBank) hypothetical protein
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
paec  Pseudomonas aeruginosa c7447m
Pathway
paec00220  Arginine biosynthesis
paec00250  Alanine, aspartate and glutamate metabolism
paec00290  Valine, leucine and isoleucine biosynthesis
paec01100  Metabolic pathways
paec01110  Biosynthesis of secondary metabolites
paec01130  Biosynthesis of antibiotics
paec01210  2-Oxocarboxylic acid metabolism
paec01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:paec00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M802_2927
   00290 Valine, leucine and isoleucine biosynthesis
    M802_2927
   00220 Arginine biosynthesis
    M802_2927
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:paec01007]
    M802_2927
Enzymes [BR:paec01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     M802_2927
    2.6.1.66  valine---pyruvate transaminase
     M802_2927
Amino acid related enzymes [BR:paec01007]
 Aminotransferase (transaminase)
  Class I
   M802_2927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGV67383
LinkDB All DBs
Position
3179566..3180777
Genome map
AA seq 403 aa AA seqDB search
MQVSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPEEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYYQQKQVEGVGIEDIYLGNGVSELIVMSMQALLNNGDE
VLIPAPDYPLWTAAVSLAGGKPVHYLCDEQANWWPDLEDIKAKITPNTRAMVIINPNNPT
GAVYSREVLEGMVELARQHNLVLFSDEIYDKILYDGAVHVSTASLAPDVLCLTFNGLSKS
YRVAGFRSGWVAISGPKQRAQSYIEGLDILANMRLCANVPAQHAIQTALGGYQSINDLVL
PPGRLLEQRNRAWELLNDIPGVSCVKPMGALYAFPRIDPKVCPIHNDEKFVLDLLLSEKL
LIVQGTAFNWPWPDHFRVVTLPRVDDLEQAILRIGSFLKGYQQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcagcaaatcgaacaagctcgccaacgtctgctatgacattcgcgggccggtg
ctcaagcacgccaaacgcctagaggaagagggtcaccgcatcctcaagctgaatatcggc
aacccggcgccgttcggtttcgaagctcccgaggaaattctccaggacgtcatccgcaac
ctgccgaccgcccagggctacagcgactccaagggcctgttcagcgcgcgcaaggcagtg
atgcagtattaccagcagaagcaggtggaaggcgtcggcatcgaggacatctacctcggc
aacggcgtgtcggaactgatcgtgatgtccatgcaggcgctgctgaacaacggcgacgag
gtgctgatccccgctcccgactacccgctgtggaccgccgccgtcagcctcgccggcggc
aagccggtgcactacctgtgcgacgagcaggccaactggtggccggacctggaagacatc
aaggcgaagatcacgccgaataccagggcgatggtgatcatcaacccgaacaaccccacc
ggcgcggtgtattccagggaagtgctggaaggcatggtcgaactggcccgccagcacaac
ctggtgctgttctccgacgagatctacgacaagatcctctacgacggcgccgtccacgtc
tccaccgcctcgctggcgccggacgtgctctgcctgaccttcaacggcctgtccaaatcc
taccgggtggccggcttccgctccggctgggtggcgatctccgggcccaagcagcgggcg
cagagctatatcgaaggtctcgacatcctcgccaacatgcgcctgtgcgccaacgtcccg
gcgcagcacgcgatccagaccgccctgggcggctaccagagcatcaacgatctggtcctg
ccgccggggcgcctgctggagcagcgcaaccgcgcctgggaactgctcaacgacatcccc
ggcgtcagctgcgtgaagccgatgggcgcgctgtacgccttcccgcggatcgatccgaag
gtctgcccgatccacaacgacgaaaagttcgtcctcgacctgctgctctcggaaaaactg
ctgatcgtccagggcaccgccttcaactggccgtggcccgaccacttccgggtggtcacc
ctgccccgcgtcgacgacctggagcaggcgatcctgcgcatcggcagcttcctcaagggc
taccagcagtaa

DBGET integrated database retrieval system