KEGG   Pseudomonas aeruginosa c7447m: M802_337Help
Entry
M802_337          CDS       T03098                                 

Gene name
rpiA
Definition
(GenBank) ribose 5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
paec  Pseudomonas aeruginosa c7447m
Pathway
paec00030  Pentose phosphate pathway
paec01100  Metabolic pathways
paec01110  Biosynthesis of secondary metabolites
paec01120  Microbial metabolism in diverse environments
paec01130  Biosynthesis of antibiotics
paec01200  Carbon metabolism
paec01230  Biosynthesis of amino acids
Module
paec_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:paec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    M802_337 (rpiA)
Enzymes [BR:paec01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     M802_337 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC MGS Sugar-bind
Motif
Other DBs
NCBI-ProteinID: AGV66450
LinkDB All DBs
Structure
PDB: 

Position
complement(371139..371810)
Genome map
AA seq 223 aa AA seqDB search
MNQDQLKQAVAQAAVDHILPHLDSKSIVGVGTGSTANFFIDALARHKAEFDGAVASSEAT
AKRLKEHGIPVYELNTVSELEFYVDGADESNERLELIKGGGAALTREKIVAAVAKTFICI
ADASKLVPILGQFPLPVEVIPMARSHVARQLVKLGGDPVYREGVLTDNGNIILDVHNLRI
DSPVELEEKINAIVGVVTNGLFAARPADLLLLGTADGVKTLKA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaggatcagctcaagcaggcagtggcacaggccgccgtcgaccacattcttccg
cacctcgacagcaagagcatcgtcggcgtcggcacaggctccaccgccaacttcttcatc
gatgccctggcccgccacaaggccgagttcgacggcgcagtagccagttcggaggccacc
gccaaacgcctgaaggagcatggcatcccggtctacgagctgaacacggtcagcgagctg
gagttctacgtcgacggcgccgacgaaagcaacgagcgcctggagctgatcaagggcggc
ggtgccgcgctgacccgcgagaagatcgtcgccgcggtggccaagaccttcatctgcatc
gccgatgccagcaagctggtgcccatcctcggccagttcccgctgccggtggaggtcatc
ccgatggctcgcagccacgtcgcccgccaactggtgaagctcggcggcgatccggtctac
cgcgaaggcgtgctgaccgacaacggcaatatcatcctcgacgtgcacaacctgcgcatc
gacagcccggtggaactggaagagaagatcaacgccatcgtcggcgtggtcaccaacggc
ttgttcgccgcccgcccggccgacttgctgctgctcggcaccgccgacggcgtcaagacc
ctcaaggcctga

DBGET integrated database retrieval system