KEGG   Pseudomonas aeruginosa c7447m: M802_4238Help
Entry
M802_4238         CDS       T03098                                 

Definition
(GenBank) hypothetical protein
Organism
paec  Pseudomonas aeruginosa c7447m
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGV68018
LinkDB All DBs
Position
4590554..4590775
Genome map
AA seq 73 aa AA seqDB search
MLESEIVAARRAYAASLGVTLSGAISNADEPVHIRHAVSNSNHNPNASNRINLGRARAYK
KRREEGDYFFIDT
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atgctcgagagcgagatcgttgcggcacgccgggcctatgccgccagcctgggagtgacg
cttagcggagcgatcagcaacgccgacgagccggtccatatccgccacgccgtcagcaat
tccaatcacaaccccaacgcctcaaaccgtatcaaccttgggagggcccgagcgtataaa
aaaaggcgcgaggaaggtgattattttttcatcgacacttga

DBGET integrated database retrieval system