KEGG   Pseudomonas aeruginosa c7447m: M802_916Help
Entry
M802_916          CDS       T03098                                 

Definition
(GenBank) ABC transporter family protein
  KO
K10025  arginine/ornithine transport system ATP-binding protein [EC:7.4.2.1]
Organism
paec  Pseudomonas aeruginosa c7447m
Pathway
paec02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:paec00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    M802_916
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paec02000]
    M802_916
Enzymes [BR:paec01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     M802_916
Transporters [BR:paec02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Arginine/ornithine transporter
    M802_916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_13 AAA_29 AAA_15 AAA_16 PRK AAA_33 AAA_23 G-alpha Mg_chelatase RsgA_GTPase AAA_22 AAA_19 AAA_24
Motif
Other DBs
NCBI-ProteinID: AGV66482
LinkDB All DBs
Position
975542..976306
Genome map
AA seq 254 aa AA seqDB search
MYKLEVQDLHKRYGSHEVLKGVSLAAKAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKI
LLNGEELKLVPGRDGALKAADSRQLQRMRSRLSMVFQHFNLWSHMSALENVIEAPVHVLG
VSKKEAIEKAEHYLAKVGVAHRKDAYPAHMSGGEQQRVAIARALAVEPEVMLFDEPTSAL
DPELVGEVLKVMQDLAQEGRTMVVVTHEMGFAREVSNQLVFLHKGLVEEHGCPKEVLANP
QSDRLKQFLSGSLK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaactggaagtccaagacctgcacaagcgctacggtagccacgaggtgctcaag
ggcgtctcgctggcggcgaaagcgggcgacgtgatcagcatcatcggctcgagcggttcc
ggcaagagcacctttctgcgctgcataaacctgctggaacagccgcacgccggcaagatc
ctgctcaacggcgaggagctgaagctggtgcccggccgcgacggcgcgctgaaggccgcc
gactcccgccagttgcagcgcatgcgctcgcgcctgtcgatggtgttccagcatttcaac
ctgtggtcgcacatgagcgccctggagaacgtcatcgaggcgcccgtgcatgtgctcggc
gtgtcgaagaaggaagccatcgagaaggccgagcactacctggccaaggtcggcgtggca
caccgcaaggacgcctacccggcgcacatgagcggcggcgagcagcagcgcgtggcgatc
gcccgggcgctggcggtggagccggaagtgatgctgttcgacgagccgacctcggcgctc
gaccccgaactggtgggcgaagtgctgaaggtcatgcaggacctggcccaggaaggccgc
accatggtggtggtgacccacgagatgggtttcgcccgcgaggtgtcgaaccagttggtg
ttcctgcacaagggcctggtcgaggaacacggctgcccgaaggaagtcctcgccaacccg
cagtcggaccgcctcaagcagttcctctccggcagcctcaagtaa

DBGET integrated database retrieval system