KEGG   Paenibacillus sp. FSL R7-0331: R70331_00795Help
Entry
R70331_00795      CDS       T03357                                 

Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
paee  Paenibacillus sp. FSL R7-0331
Pathway
paee00340  Histidine metabolism
paee01100  Metabolic pathways
paee01110  Biosynthesis of secondary metabolites
paee01230  Biosynthesis of amino acids
Module
paee_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:paee00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    R70331_00795
Enzymes [BR:paee01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     R70331_00795
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     R70331_00795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: AIQ50227
UniProt: A0A089KP57
LinkDB All DBs
Position
154048..154731
Genome map
AA seq 227 aa AA seqDB search
MSQEQEAIIEGIRWNESGLLPAVVQDARTLEVLMFAYMNPESLQRTLTSGQTWFWSRSRS
ELWHKGGTSGNTQAVTSIHYDCDSDTLLVKVNPEGPACHTGENTCFYREIPLTGQTAAEP
QRTASADEGRFAVLGELERVIAERETERPEGAYTTYLFDKGVDKILKKVGEEASETIIAA
KNKDNAELRLEVSDLIYHLLVLLQERKLPLDEILDELSARHERPRRD
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagaacaagaagcaataatcgaaggtatccgctggaacgaatccggcttgctg
cctgccgtagtgcaggatgcgcgtacactggaggtgctgatgttcgcctacatgaatccg
gagtcgctgcagcgtacgcttacgagcggccagacctggttctggagccgttcccgcagc
gaactatggcataaaggcggaacctcaggcaacacccaggcggttacttccattcattat
gactgcgacagtgatacgctattggtcaaggtgaatcctgaagggcctgcctgccataca
ggggagaatacctgcttttaccgtgaaatcccgcttaccggacagacagcagcggagcct
cagcgcaccgcaagtgcagatgaagggcgttttgccgtactgggcgagctggagcgggtg
attgccgagcgggaaaccgagcgccctgagggtgcttatacaacctatctgttcgataag
ggtgtagacaagattcttaagaaggtgggcgaggaagcctccgagacgattatcgccgcc
aaaaataaagataatgccgagctccgccttgaagtaagcgatctgatctatcacctgctg
gtgctgctgcaggagcgcaagctgccgctggacgagattctggatgagctgagcgcccgc
cacgaacgtccgcgccgcgactga

DBGET integrated database retrieval system