KEGG   Paenibacillus sp. FSL R7-0331: R70331_10260Help
Entry
R70331_10260      CDS       T03357                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
paee  Paenibacillus sp. FSL R7-0331
Pathway
paee00020  Citrate cycle (TCA cycle)
paee00480  Glutathione metabolism
paee01100  Metabolic pathways
paee01110  Biosynthesis of secondary metabolites
paee01120  Microbial metabolism in diverse environments
paee01130  Biosynthesis of antibiotics
paee01200  Carbon metabolism
paee01210  2-Oxocarboxylic acid metabolism
paee01230  Biosynthesis of amino acids
Module
paee_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paee_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:paee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    R70331_10260
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    R70331_10260
Enzymes [BR:paee01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     R70331_10260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIQ51859
UniProt: A0A089M530
LinkDB All DBs
Position
2428266..2429561
Genome map
AA seq 431 aa AA seqDB search
MLKLEKYDLPTEGEQITIEDGKLVVPANPIIPFIEGDGTGRDIWKASKRVLDAAVDKAYG
GEKKLAWYEVFAGEKAFNTYGEWLPNDTLEAIREYIVAIKGPLTTPIGGGIRSLNVALRQ
ELDLYVCLRPVRYFDGVPSPVKHPELVDMVIFRENTEDIYAGIEYKEGSEEVKKVIEFLQ
KEMGVNKIRFPETSGIGIKPVSSEGSKRLVRAAVEYAIKHGRKSVTLVHKGNIMKFTEGA
FKNWGYEVAEQEFGDKVFTWNQYDVIKEKDGEAAANAAQKEAETAGKIIIKDAIADIALQ
QVLTRPTDFDVIATLNLNGDYLSDALAAQIGGIGIAPGANINYVTGHAIFEATHGTAPKY
ADKDVVNPGSVILSGVMLLEHLGWQEAADLIYKGMTTAINNKTVTYDFARQMEGATELKC
SAFADEIIKHL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaactcgagaagtacgatctgccgacagaaggcgaacaaattacgattgaagat
ggcaagctggtggttcctgctaatccgattattccgtttatcgaaggagacggtacagga
cgcgacatctggaaagcatccaagcgcgtactggacgctgctgtagataaagcatacggc
ggggagaaaaagcttgcctggtacgaagtgtttgccggcgagaaagccttcaatacatat
ggtgaatggctgccgaatgatacgctggaagcaatccgtgagtatatcgtagcgatcaag
ggaccgctgacaaccccgattggcgggggaatccgctcactgaacgtggcgctgcgccag
gagctggatttgtacgtgtgcctgcgtccggtacgttattttgacggcgtgccttcaccg
gttaagcatcctgagcttgtggatatggttattttccgtgagaatacagaggatatttat
gccggcatcgagtataaagaaggctctgaagaggtgaagaaagtaattgagttcctccag
aaggaaatgggtgttaacaaaatccgcttcccggagacctccggtatcggtatcaagcct
gtatcctccgaaggttccaagcgtcttgtgcgcgctgcagttgagtatgcaatcaagcac
ggacgcaagagcgttactctggtgcataagggcaacatcatgaaatttactgagggcgca
tttaagaactggggatatgaagtggctgaacaggagttcggcgacaaggtgtttacctgg
aaccaatatgatgtaattaaagagaaggacggcgaagcggcagcaaatgcggcccagaag
gaagcagaaacagccggcaaaattatcatcaaggatgctatcgcggacatcgcgctgcag
caggtgctgacccgtccgactgactttgatgttatcgctacactgaatctgaacggggac
tacctgtctgacgcactggctgcacagatcggcggtatcggcatcgcacctggggcgaat
atcaactacgtgacaggacatgcgatttttgaggcgactcacggaaccgctccaaagtat
gctgacaaggacgtagtgaatccgggatcggttatcctctcgggcgttatgctgcttgaa
catctcggctggcaggaagcggctgatctgatctacaaaggcatgactactgcaattaac
aacaagacggtaacttacgactttgcccgccagatggaaggcgcgacagagctgaaatgc
tcggcctttgctgatgaaattattaaacacctgtaa

DBGET integrated database retrieval system