KEGG   Paenibacillus sp. FSL R7-0331: R70331_28145Help
Entry
R70331_28145      CDS       T03357                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
paee  Paenibacillus sp. FSL R7-0331
Pathway
paee00620  Pyruvate metabolism
paee00680  Methane metabolism
paee01100  Metabolic pathways
paee01120  Microbial metabolism in diverse environments
paee01200  Carbon metabolism
Module
paee_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:paee00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    R70331_28145
  Energy metabolism
   00680 Methane metabolism
    R70331_28145
Enzymes [BR:paee01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     R70331_28145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 OTCace
Motif
Other DBs
NCBI-ProteinID: AIQ54984
UniProt: A0A089MED1
LinkDB All DBs
Position
complement(6226237..6229029)
Genome map
AA seq 930 aa AA seqDB search
MTELTTAVSKSNSNNLLRRDVRFLGNILGEVLVHQGGNELLEVVEKIRETSKSLRSLFLP
ELHNEFKELISSLDPENRHQVIRAFAIYFQLVNIAEQNHRIRRKRDYERSAGDTVQPGSI
ESAIQELRERDFSQEDVHDIMNNLSLELVMTAHPTEAMRRAILDIHKRISDDVMGLDNPT
LTFREREQLREKLLNEVITLWQTDELRDRKPTVLDEVRNGMYYFHETIFQVLPDVYQELE
RCLSKYYPGQNWHVPTYLRFGSWIGGDRDGNPSVTAAVTMQTLRLQRKLAIREYQRIMRE
LMQYLSFSTSIVSVTDELLDSIEQDRGIIKLNRVDAWRNDNEPYRIKLSYMISKTQNVLD
DERKGTPERYATPQQFIDDLNVIDRSLRHHFADYVADTYIKKLIRQVELFGFHTAALDVR
QHSQEHENAMAEILAKMNITQDYAKMPEDQKVTLLESILNDPRPLTSPYQSYSESTEECL
AVYRTVYLAQEEYGKQCITSYLISMAEAASDILEVMVFSKEVGLFRKDNDGTVVCTLQAV
PLFETIDDLHNAPQIMKTLLSMPIYREAVRAMNDLQEIMLGYSDSNKDGGVVTANWELRV
ALKQITATADEFGIKLKFFHGRGGALGRGGMPLNRSILAQPASTIGGGIKITEQGEVISS
RYSMQGIAYRSLEQATSALVTAAIHARTPQADLYEAKWDEIVARISEVSLTKYQDLIFRD
PDFLSFFKESTPLPEVGELNIGSRPSKRKNSDRFEDLRAIPWVFAWTQSRYLLPAWYAAG
TGLQSFYEGKEENMKIMQTMYADFSFFTTLIDTLQMAIAKADLVIAKEYASMGKNDEARQ
RIFGQIQAEFKLTSELILKITGQHEILDNVPVIQESIRLRNPYVDPLSYLQVQLLSELRV
LRDAEGDDAELLREVLLTINGIAAGLRNTG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacttacgacagctgtcagcaaaagcaattccaataacttgctgcggcgtgac
gtacggttcctggggaacatcttgggcgaagtcttggtacatcaaggcggtaacgaacta
ctggaggtcgtggagaagatccgcgaaaccagtaaatcgctgcgctcattatttttgcct
gaactgcacaatgaatttaaagagctgattagttcactggatcctgagaatcgccaccag
gtgatacgggcgttcgccatttattttcaattggtgaatattgctgagcagaaccaccgg
attcgccgtaagcgcgattatgaacgctcagccggggatacagtacagccgggatctatc
gaaagtgcgattcaggagctccgtgaacgggatttctcccaagaggatgttcatgatatt
atgaataacctgtccttggagctggtcatgaccgctcatcctacggaagcaatgcggagg
gccattcttgatattcacaaacggatctccgatgatgtgatgggtctcgacaatccgacg
ctgaccttccgcgaacgtgaacagctccgcgagaagctgctgaacgaagtgattaccctt
tggcagacggatgaattgcgtgaccgcaagccgacagtgcttgatgaagtacgcaacggg
atgtattacttccatgagacgattttccaggtactgccggatgtgtatcaagagcttgaa
cgatgtctaagtaaatactatccggggcagaattggcacgtgccgacttatctgcgtttt
ggatcatggatcggcggcgaccgtgacggtaatccgtctgtaaccgcggctgtgactatg
cagacactgcgccttcagcgtaagctcgctattcgtgaatatcagcgcattatgcgtgaa
ctgatgcagtatctgagctttagtacaagcatcgttagtgttacggatgagctgctggat
tcgatcgagcaggaccgagggatcattaagctgaaccgtgttgacgcctggcgtaatgac
aatgagccttaccggattaagctgagctacatgatttccaagacacagaacgtgctggac
gatgagcgaaaaggaacgccggagcgctacgcgactccgcagcaattcatagatgatctg
aacgtaattgaccgcagcctgcggcatcactttgccgactacgtggcagatacctacatt
aagaagctgatccgtcaggtagagctgttcggcttccatacagctgcgctggatgtccgt
cagcacagccaggagcatgagaacgcaatggctgagattttggctaagatgaacatcact
caggattacgctaaaatgccggaagatcagaaggtaacgcttcttgagtccattctgaac
gatccgcggccgctgacttccccgtaccagtcctacagtgagagtactgaggaatgcctt
gcggtataccgtacggtgtatctggcacaggaggaatacggcaagcagtgtatcaccagc
tatctgatcagtatggcggaagcggcgagtgacattcttgaagttatggtattctccaaa
gaagtaggcttgttccgtaaggataatgatggaacagtagtctgcaccttgcaggcggtc
ccgctgtttgaaaccattgatgacctgcataacgctccgcagattatgaagacactgctc
agcatgccgatctaccgtgaggcggtacgggcaatgaacgatctgcaggaaattatgctc
ggctattccgacagcaacaaagacggcggcgtggtgactgcgaactgggagctgcgtgtt
gcccttaagcagattacagctactgccgatgaattcggcatcaagcttaagttcttccac
ggacgcggcggagcgcttggacgcggcggtatgccgctgaaccgcagcattctggcccag
ccggcttcgaccatcggcggcggaatcaagattaccgagcagggcgaggttatctcctcc
cggtattcgatgcagggaatcgcataccgcagtctggagcaggctacctctgcgctggtg
acagcggctattcatgcgagaacgcctcaggctgacctgtatgaagcaaaatgggatgaa
atagtagcccgtatttccgaggtgtccttaaccaaatatcaggacctgatcttccgtgat
ccggacttcctgtccttcttcaaagaatcaaccccgctgcctgaggtgggcgagctgaac
atcggctcacgtccatccaagcggaagaacagcgaccgctttgaggatctgcgtgcgatt
ccatgggtattcgcttggacgcagagccgatatctgctgccggcctggtatgctgccgga
acaggactgcagagcttctatgaaggcaaggaagagaatatgaagatcatgcagaccatg
tatgccgacttctcgttctttacgacgctgattgatacactgcagatggcgattgcgaag
gcagatctggttattgccaaggagtatgcctccatgggcaaaaacgacgaagcccgccag
cggatcttcggccagattcaggcggaattcaagctgacctctgagctgattctcaagatc
accggccagcatgaaattctggataatgtcccagttattcaggaatcgattcgtctgcgc
aacccttacgttgatccgctcagctatctgcaggtacagcttctgtcagagctcagagta
ttgcgtgatgctgagggcgatgacgccgaactgctgcgtgaggtactgcttactattaac
ggcattgctgcaggcctgcggaatacgggctga

DBGET integrated database retrieval system