KEGG   Paenibacillus sp. FSL R7-0331: R70331_30915Help
Entry
R70331_30915      CDS       T03357                                 

Definition
(GenBank) protein lplB
  KO
K17319  putative aldouronate transport system permease protein
Organism
paee  Paenibacillus sp. FSL R7-0331
Pathway
paee02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:paee00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    R70331_30915
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paee02000]
    R70331_30915
Transporters [BR:paee02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative aldouronate transporter
    R70331_30915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AIQ55456
UniProt: A0A089L1Y2
LinkDB All DBs
Position
6843801..6844721
Genome map
AA seq 306 aa AA seqDB search
MFRFRGEQMKAFFRQWQLQSMVIPGIVWMVIFCYLPMFWLVIAFMDYSIAKPMLESPFVG
LKHFEAFVSDDRFWRSIRNTLGMSSIKLILGFPIPILFALLLNEIRSLRFKRTVQTISYL
PHFIAWTIFGGIALNWLGEGGVINQLMMAIGLQDREILFNSDAKYFWWITFFTDTLKETG
WSAIIYIAAISGIDPGLYEAAELDGAGRWQRMWHITVQSIRPTIAILFILAVSGILGSNF
EQIFMLKNNMNMKMAESLDLYIYNMGLVSGRHSFSTAVLFARSIVALGLLFMANQTSKKL
TGDSIF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgattccggggggaacaaatgaaagcgttttttagacagtggcagctgcaaagc
atggttattccgggcattgtctggatggttattttttgttatcttccgatgttctggctc
gttatcgcctttatggactacagtatcgcgaagcccatgcttgaatcgccgtttgtcggg
ctgaagcattttgaagccttcgtgagtgatgaccgcttctggcgttcgatccgcaataca
ctggggatgagcagcatcaagctgatcttaggctttccgattccgattctgttcgcgctg
ctgcttaatgaaatccgcagcctgcgcttcaagcgtacggtgcagaccatatcgtacctg
ccgcattttatcgcgtggacgatcttcggcgggattgcgctcaactggctgggcgaaggc
ggtgttatcaatcagctgatgatggcgatcgggctgcaggaccgcgagattctttttaac
agtgatgccaaatacttctggtggattaccttttttaccgatacgctgaaggaaacaggc
tggagtgccattatctacattgcggctatttcgggcattgatcccggattatatgaagct
gcggagcttgatggtgcaggacgctggcagcggatgtggcatattaccgtgcagagcatc
cgtccaacaatcgctatcctgttcattctcgcggtgagcggtattctgggcagtaatttt
gaacagatttttatgctgaagaacaatatgaacatgaaaatggcggaaagcctcgacctg
tacatttacaacatggggcttgtgtcaggacggcattccttctccacagcggtgctgttt
gcccgatccattgtggcgctggggctgctgttcatggcgaatcagacatccaaaaaactg
accggggacagtatcttctag

DBGET integrated database retrieval system