KEGG   Paenibacillus sp. FSL R5-0345: R50345_00860
Entry
R50345_00860      CDS       T03333                                 

Definition
(GenBank) thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
paef  Paenibacillus sp. FSL R5-0345
Pathway
paef00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:paef00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    R50345_00860
Enzymes [BR:paef01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     R50345_00860
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox NAD_binding_8 DAO FAD_binding_2 HI0933_like GIDA FAD_oxidored Thi4 K_oxygenase NAD_binding_7 FAD_binding_3 Shikimate_DH
Other DBs
NCBI-ProteinID: AIQ33333
LinkDB
Position
170005..170970
AA seq 321 aa
MYKTIVIGTGPAGLTAAIYLARANLNPLVIEGMQPGGQLTTTTEVENFPGFPEGILGPDL
MDNMRKQAERFGAEFKNGWVDSVDFSQRPFKVTVDGLGVLEAESVIISTGASARYLGIPG
EQENVGRGVSTCATCDGFFFRNKKIIVIGGGDSAMEEASFLTRFASSVTVVHRRDELRAS
KIMQDRARDNSKVAWALNRTPLEVTTDESGVKGLKVRNNETGLEELIEADGVFVAIGHTP
NTGFLGGQITTDTNGYIVVNPGTTETNIPGVFACGDVQDTRYRQAISAAGTGCMAAMDAE
KYLEGTMVHDWSENLGSNSKV
NT seq 966 nt   +upstreamnt  +downstreamnt
atgtacaaaacgattgtaatcggaacaggcccggccgggcttactgctgctatttatttg
gcacgtgccaaccttaacccacttgtaattgaaggtatgcagcctggtggacaactgaca
acgacaacggaagtggagaactttccaggttttccagaggggattctcggcccggattta
atggacaacatgcggaagcaggctgaacgttttggtgctgaattcaagaatggttgggtg
gactccgtggatttttcacagcgtccatttaaagttacagtagatggattgggtgtatta
gaggcagagtcggtgattatctctaccggtgcttctgccagatatttaggaataccaggg
gagcaggagaatgtaggccgtggggtcagcacttgtgctacttgtgacggtttcttcttc
cgcaataagaagatcatcgtgatcggtggtggagactccgcgatggaggaagccagcttc
ctaacaagatttgcttccagtgtaaccgtggttcatcgtcgtgatgagcttagggcttcg
aagattatgcaggatcgcgcacgtgacaacagtaaggttgcgtgggcgcttaatcgcaca
ccgcttgaggttacaacggatgagtccggtgttaaagggctaaaggttaggaacaatgag
acaggtcttgaggaactcatcgaagcagacggagtatttgtcgctattggacatacgccg
aatacgggtttcttgggtggtcagattaccacggatactaacggttatatcgtggtgaat
ccaggtactactgaaacgaacattccaggcgtatttgcttgtggtgacgtacaggatacc
cgttatcgccaagcgatttctgcagcaggcaccggctgtatggcagcaatggacgctgag
aaatatcttgaaggtacaatggtgcatgactggagcgaaaacttgggtagtaatagcaaa
gtttaa

DBGET integrated database retrieval system