KEGG   Paenibacillus sp. FSL R5-0345: R50345_01170
Entry
R50345_01170      CDS       T03333                                 

Definition
(GenBank) pyridine nucleotide-disulfide oxidoreductase
  KO
K21739  probable pyridine nucleotide-disulfide oxidoreductase
Organism
paef  Paenibacillus sp. FSL R5-0345
Brite
KEGG Orthology (KO) [BR:paef00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    R50345_01170
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 DAO TrkA_N K_oxygenase 3HCDH_N HI0933_like UDPG_MGDP_dh_N 2-Hacid_dh_C NAD_binding_8 Thi4 FAD_binding_2 NAD_binding_2 Shikimate_DH Runt AlaDh_PNT_C TPR_3 DUF1947 T3SS_ATPase_C
Other DBs
NCBI-ProteinID: AIQ33389
LinkDB
Position
complement(242522..243862)
AA seq 446 aa
MNKFDAIIIGFGKGGKTLATELANRKWKVAVIERSKEMYGGTCINIACIPTKSLAYQAHQ
GKDYEEAIHNKDQLISFLRQKNYDNLNQNENIEVINGEASFLSDHEVQVKEAGETKILTA
DKIFINTGAETIIPTIDGIQDSKFVYTSTSIMDLKELPTKLAIIGGGYIGLEFASIYSQF
GSQVTVLEGSSKFIPKEDRDVAEAVLQTFTKKNIEVKLKAKVIGLKDVKDGTVISFSIDG
AIQELKVDAVLVATGRKPNIEGLNLEAAGVEVTDRGAIKVDPSLKTSVPHIWALGDVKGG
LQFTYISLDDYRIVRNDLFGDHSHTTNDRDAVPYSVFIDPPLSRVGISEEAATEQGLEIK
VAKLPSAAIPRARLINETEGFLKAIVDAKTNKILGATLFCAESSEVINIVSMAIQTGQDF
TFLRDHIFTHPTMSEALNDLFSQIKE
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgaacaagttcgacgctattattattggtttcggtaaaggcggaaagacccttgccaca
gaactagctaatcgaaaatggaaagtagccgttattgaacgatctaaggaaatgtacggt
ggaacctgcattaacatcgcctgcatccctaccaaatccttagcttaccaagcacatcaa
ggcaaagattatgaagaagcgatccataacaaggatcaactgatttcatttctacgccag
aaaaattacgataatctaaatcagaacgagaatatagaagttattaatggagaagcttcc
ttcttatcagatcacgaagttcaagtgaaggaagccggtgagacgaaaatcttaaccgcc
gacaaaatcttcattaatacgggtgctgagaccatcattccaacgattgacgggatacaa
gatagtaagttcgtttataccagcacgtccattatggatcttaaggagctcccaactaaa
ctagccatcattggtggtggttatattggtttggaattcgcttcgatctacagtcaattc
ggctcacaggttacggtgctggagggttcctcgaaattcatccctaaagaagaccgcgat
gtcgcggaggccgtcctccaaacctttaccaagaagaacattgaggtcaaactgaaggca
aaggttataggactgaaggatgttaaagatggaacagttatctccttttcgatagatggc
gctattcaagaattgaaagtcgatgctgtactggtagcgacaggtagaaaaccaaacatc
gagggattaaatctagaagcagccggtgtagaagttacagatcggggtgctattaaggtg
gacccttccctaaaaacctccgttccccatatatgggctcttggcgatgtcaaaggcgga
ttacagtttacctatatatctttagacgattatagaatcgtacgaaatgatctcttcggc
gatcattcccataccacaaatgaccgtgacgctgttccgtacagcgtatttatagatcct
ccactatccagagtaggaattagtgaagaagcagctaccgaacaaggacttgaaattaaa
gtcgcgaaattgccttcagcagctattccacgtgcccgcttaattaacgaaactgaaggc
ttcctaaaagctattgtggatgcaaaaaccaataaaattctcggagctacattgttctgt
gcggaatccagtgaagtgattaatatcgtgagtatggctattcaaacagggcaagatttc
acctttttgagagatcatatctttactcaccccacaatgagcgaggctttgaatgatttg
ttctcacagatcaaagaataa

DBGET integrated database retrieval system