KEGG   Paenibacillus sp. FSL R5-0345: R50345_02805
Entry
R50345_02805      CDS       T03333                                 

Definition
(GenBank) pyridine nucleotide-disulfide oxidoreductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
paef  Paenibacillus sp. FSL R5-0345
Pathway
paef00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:paef00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    R50345_02805
Enzymes [BR:paef01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     R50345_02805
SSDB
Motif
Pfam: Pyr_redox_2 DAO FAD_binding_2 FAD_oxidored GIDA Pyr_redox_3 HI0933_like NAD_binding_9 FAD_binding_3 NAD_binding_8 3HCDH_N Lycopene_cycl Pyr_redox DUF2590 AlaDh_PNT_C UDPG_MGDP_dh_N ID
Other DBs
NCBI-ProteinID: AIQ33676
LinkDB
Position
complement(596794..597360)
AA seq 188 aa
MYEIAVIGAGPAGASAALFAAKAGKKTLLIDNDKGMTRRGWFENFYGISEVGGPDLVETG
HKQAVKFGAELVSEQAINLTSSGNGFVIETEDGIIYEAKHVILATGALTDLAAKAGVETK
DGTEPRIKTVVAVDAEGKTNIPGIWAAGTVAGVSVHAIITAGDGAKVAINVISELNGARY
VDHDVLKA
NT seq 567 nt   +upstreamnt  +downstreamnt
atgtacgaaatcgccgtaattggagccggccccgccggtgcaagcgcagccctgttcgcc
gccaaggcgggcaaaaaaacgctgctgatcgacaatgataagggcatgacccgcagagga
tggttcgagaacttttatggaatttccgaagtaggtggtcctgatctcgtagaaaccgga
cataagcaagccgttaaatttggcgctgagctggtttcagaacaagctatcaacctcaca
tccagcggcaacggattcgtcattgaaaccgaagacggaatcatttatgaagcgaagcat
gtcattcttgcaacgggtgcccttacggatctagccgctaaagctggcgtggagacaaaa
gatggtacagagcctagaatcaaaactgtagtcgctgttgatgcagaaggcaaaacaaat
atcccaggcatttgggctgcaggtaccgttgccggagtaagtgtacatgccattattaca
gcaggtgatggcgcgaaggtagcgatcaatgtgataagtgagctgaacggtgcacgttac
gtggatcatgatgtgctaaaggcttaa

DBGET integrated database retrieval system