KEGG   Paenibacillus sp. FSL R5-0345: R50345_04800Help
Entry
R50345_04800      CDS       T03333                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
paef  Paenibacillus sp. FSL R5-0345
Pathway
paef03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:paef00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    R50345_04800
Enzymes [BR:paef01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     R50345_04800
DNA repair and recombination proteins [BR:paef03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     R50345_04800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AIQ34021
LinkDB All DBs
Position
complement(1080471..1081418)
Genome map
AA seq 315 aa AA seqDB search
MKLQPIIPFEPILAGQLPAGNQWIAQIKWDGVRMLSYYNGSTTQLINRRGNYRTAQYPEL
TDVSAYCKADSVILDGEIIALKDGKPSFHEVMRRDSLKNGSTISVVRHQVPVIYMIFDIL
FYNGQSPMDQPLSSRQQLLNDILLPHPHVQAVPSYTDPTELFAAAQSQSLEGIVCKDINS
TYAPGGKDKRWQKRKIISDLTAVAGGVTFRDGIVNALLLGLYDDKGNLHYIGHAGPGKLT
VQDKRDLTAEVQHLKIDQMPFTADPQRGKGAFWIKPKLVFKVHFLEWNTSGTLRQPVTQA
RVDLPPESCTMEQKG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttcagcctattattccttttgaacctatactggctgggcagcttccagcaggc
aaccagtggattgcacagattaaatgggatggcgttcgaatgttgtcctattacaacgga
agcactactcagcttattaacagacgtggaaattaccgtacagcgcaatatcctgagctt
actgatgtatctgcttactgcaaggctgattccgttattcttgatggtgaaatcattgca
ctcaaggacggcaagccctcatttcacgaggtaatgcggagggacagcttaaagaatggc
tccaccatttccgtcgttaggcatcaggttcctgtcatttatatgatttttgatattctg
ttttataatggccaatcgccgatggatcagcctttatcctcacggcagcagctgctaaac
gatattctgctgccgcatccccatgttcaggccgtacccagttataccgatcccacagaa
ttattcgccgctgctcagagtcagagcttagagggaatcgtctgtaaggatatcaacagt
acttatgctcccggtggaaaagataaacgctggcagaaacgcaaaatcatttctgatctt
acggcagtagccgggggtgtaacgttccgagacggcatcgtcaatgcgctacttcttggg
ctgtatgatgataaagggaatttgcattatatcggacatgccgggccaggaaaattgact
gtacaggataaacgcgacttaactgcagaggtacagcatttaaaaatagatcaaatgccc
tttacagctgatccccagcgagggaagggtgctttttggataaaaccgaagcttgtcttc
aaagttcattttttggaatggaatacctcaggcactcttcgtcagccggttactcaagct
agggtagatcttcctcccgaatcatgtactatggagcaaaaaggataa

DBGET integrated database retrieval system