KEGG   Paenibacillus sp. FSL R5-0345: R50345_07615
Entry
R50345_07615      CDS       T03333                                 

Definition
(GenBank) CoA-disulfide reductase
Organism
paef  Paenibacillus sp. FSL R5-0345
SSDB
Motif
Pfam: Pyr_redox_2 DrsE_2 Pyr_redox Pyr_redox_3 TusA Rhodanese Pyr_redox_dim DrsE NAD_binding_8 DAO HI0933_like Lycopene_cycl 3HCDH_N TrkA_N
Other DBs
NCBI-ProteinID: AIQ34491
LinkDB
Position
complement(1672965..1675520)
AA seq 851 aa
MSKKVLIVGGVAGGASAAARLRRLDEEAHIVMFERDPYISFANCGLPYYIGGSIQDRSKL
LVQTPEAMHKRFNIDVRIQSEVVSIDPVNKKVRVESKEKGSYEESYDALILSPGAKPIRP
NLPGIESSKIHMLRNIPDTDKIKTKVAAEGTRSAVVIGGGFIGVEMAENLREAGLEVSLI
EAGPQILAPFDPEMSSILAKELDEHGVNLIFSDMVQGFADVGEQIEVQLASGTVLQSDMV
LLAIGVSPDTSFLKDSGLEFGPRGHILVNERMETNLDQVYAVGDAIEVVDFVNGTKTAIP
LAGPANKQGRIAADNVSGLNTTYKGSQGTSIIKVFGITGASTGNNEKTLQRLGLPYHVIY
VHPSSHATYYPGATPISMKLIFDPKGTVLGAQAVGYSGVDKRIDDIATVIRFRGTVTDLS
ELELSYAPPYSSAKDPVNMAGFAAENILQGMTTVFVPKDLEGRDKNNTILVDVRSEIEHA
NGHIEGSINIPVDDLRGRLSELDSSKEIWVYCQVGLRGYTASRILQQKGFRVKNLTGGYK
TYQLSKFTPTKKDISAPTATISAASKEIAAAGSGSATASGSAMATATRNENGIPVSAPVK
QELDLTPDSVLDACGLCCPGPLIQVKMSMDPLLDGQILKVTASDPGFYEDIKAWARMSKH
TLLQLTKLPTGMIEAYLCKGLSEESALAGAHPVQTSNASTMVVFSGDLDKAIASFIIANG
AASSGKKVTMFFTFWGLNIIRKDEKVPVNKNFIGKMFGAMMPRGSRKLTLSNMNMMGMGS
KMIRSVMKNNNVSSLEELIQMAVDQGVEIVACQMSMDLMGITREELIDGVKIGGVGYYLG
QADQSNHNLFI
NT seq 2556 nt   +upstreamnt  +downstreamnt
atgagtaaaaaagtactgattgtcggaggagttgcaggaggcgcatcagccgccgccagg
cttcggagattagatgaagaggctcatattgtaatgtttgagcgtgatccgtacatttct
tttgccaattgcggactaccttattatatcggaggttccattcaggaccgttccaagctg
ctggtgcagacaccggaggcgatgcataaacggtttaacatcgatgttcggattcaaagc
gaagtggtgtctatcgaccctgtgaacaagaaagtgcgagtagaaagtaaagaaaaaggc
tcctatgaagagagctatgatgcgcttattttatcacccggtgctaagccaattcgtccg
aatctacctggtatcgagagttccaaaattcacatgctgcgcaacattcccgacactgac
aaaatcaaaaccaaagtcgcagccgaaggcactcgttcagccgttgtgattggtggtgga
tttatcggtgttgagatggctgagaaccttagagaagctggactggaagtatccttgatc
gaggcgggtccgcaaatcttagctccgttcgatcctgaaatgtcttctattttggcaaaa
gagcttgatgagcatggcgttaatcttattttttcggatatggttcaagggtttgcagat
gttggtgaacaaatagaagttcaattggcaagtggcacggtgctgcaaagtgatatggtt
ctgctggctatcggcgtttcgccggatacctctttcctgaaggatagtggcttagagttc
ggtccacgcgggcatatcttggtcaacgagcgtatggagacaaatttggatcaggtttac
gctgtcggtgacgcgatcgaagtggtggatttcgtgaacggaactaaaaccgccattcca
ttagcaggccctgccaataaacaaggtcggattgcagcagacaacgttagcggtctaaac
actacttataaaggttcccaaggaacttccattatcaaagtatttggaatcacaggtgct
tctaccggcaataacgaaaaaacactacagcgtttgggcttaccttatcacgtgatttac
gtacatccaagctctcatgcaacttattatccgggggcaactccgatatctatgaagctg
atttttgatccaaaaggtacggtgctaggagcacaagctgtcggttacagcggagtagat
aaacgtatcgacgatatcgccacagttattcggttcagaggtacggtcactgatttatcg
gaattggagctttcttacgcccctccttattcttccgctaaagatccggtgaacatggct
ggctttgccgctgaaaatattttgcaaggcatgaccacggtattcgttccaaaggattta
gaaggacgcgacaagaacaacaccattttagttgacgtgcgttcggaaatcgaacatgcc
aacggccatattgaaggctccattaatatccctgtagatgatttgcgtggtcgtctaagt
gagcttgactctagtaaagaaatttgggtgtattgccaagttggacttagaggctatacg
gcttcccggattttgcagcaaaaaggtttccgtgtgaagaatctgaccggcggctataag
acgtaccaactgagcaaatttactcctacgaaaaaagatatctcagcgccaaccgctacg
atttcagcagccagcaaagagattgcagcagcgggatctgggtcagccacggcgtctggg
tcagcgatggcgacggccacgagaaatgaaaatgggattcccgtatccgcaccagtcaaa
caagaattagatctaacacctgattccgtgctagatgcttgcggactatgctgtcccggg
ccgctgattcaagtcaagatgagcatggacccgctcttggacggacaaatcttgaaggta
acggcttccgatccgggattctatgaagatattaaggcatgggctcgtatgtctaagcac
acgcttttacaattaacgaagctgcctacgggcatgatcgaagcttatctgtgcaaagga
ttgagcgaagaatccgcactagcaggagcacaccccgtccaaactagtaacgcaagtacg
atggttgtgttcagcggggatttggataaagcgattgcttccttcatcattgctaatgga
gcagcctccagcggcaaaaaagtaacgatgttctttaccttctggggcttaaacattatc
cgcaaggatgagaaagtacctgtgaacaaaaatttcatcggaaaaatgttcggagcgatg
atgccacgcggcagccggaagctaaccctttccaatatgaacatgatgggcatgggctcc
aaaatgattcgttctgtaatgaagaacaacaatgtctcttctttggaagagttgattcag
atggctgtcgaccaaggtgtcgagatcgttgcctgccaaatgtctatggaccttatgggc
atcacccgtgaagaactgatcgacggcgtaaaaatcggcggtgtagggtattacctcggt
caagccgatcaatctaatcataatctatttatctaa

DBGET integrated database retrieval system