KEGG   Paenibacillus sp. FSL R5-0345: R50345_12760Help
Entry
R50345_12760      CDS       T03333                                 

Definition
(GenBank) 3-carboxymuconate cyclase
  KO
K07404  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
paef  Paenibacillus sp. FSL R5-0345
Pathway
paef00030  Pentose phosphate pathway
paef01100  Metabolic pathways
paef01110  Biosynthesis of secondary metabolites
paef01120  Microbial metabolism in diverse environments
paef01130  Biosynthesis of antibiotics
paef01200  Carbon metabolism
Module
paef_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
paef_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:paef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    R50345_12760
Enzymes [BR:paef01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     R50345_12760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactonase DUF1513 SGL SBP56
Motif
Other DBs
NCBI-ProteinID: AIQ35406
LinkDB All DBs
Position
2862421..2863527
Genome map
AA seq 368 aa AA seqDB search
MEKQTKLLLFTGSYASATESGVQVFEFDGEAGGTLKLIDSVQGLTNPTFVNVDATALRLY
AIGEKPNGEGGKEGEVVTFAIDAKSGKLSELNRIATMPASGNGQTTTCHISRDLNNEYVV
VCSYHGGTVGLITLDEEKVASQLSDVAIHSGHGQHPERQDRPHPHSAIFSPDGQYLFVSD
LGLDIIRSYRINRDLNKLEVHADTVLHPGAGPRHFTFHPDGKSAYVINEVDSTITSFTYD
SARGTLHTVDTVSTLPEDFKEENTCAEIATSIDGKYLYASNRGADNIAVFAVDPATAKLT
LIEYVSTRGGHPRHFSLTPDGAYLIVANRDANNLVVFSIEAASGRLVFTGNTAEVSKPVC
VKPVIFPV
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagcagactaagttattgctgtttacgggttcttatgcaagtgccacggaaagc
ggtgtgcaggtatttgaattcgatggcgaagcaggaggtacgttaaaattaatcgactcg
gttcagggcttaactaaccctacctttgttaatgtggatgctacagcgctgcgtttatat
gccataggagaaaagccgaatggtgagggtggaaaagagggcgaagtcgttacctttgca
atcgatgctaagagtgggaaattgagcgaattgaaccgaatagccacaatgcctgcttca
ggtaatggccaaacgaccacatgtcatatttctagagacctaaacaatgaatacgttgtt
gtatgtagttatcatggtggcactgtaggcttgattacattagatgaagaaaaagttgct
agtcaactttcggatgtcgccattcattccggccacggtcaacaccctgaacgtcaggat
cgcccgcatccccattcagctatcttcagtccggacgggcagtatctgtttgtttctgat
cttggtctggatatcattcggtcctacagaatcaacagagatttgaacaaactagaagtt
cacgctgatacggtgcttcatccgggagcgggacctcgtcattttacttttcatccagat
ggaaagtcagcttatgtaataaacgaagtggattccacgataacatcgtttacatatgac
agtgctagaggtactcttcacactgtagatacagtttctactttgcctgaggattttaag
gaagagaatacttgtgccgaaattgctacttcaatagatggaaaatatctttacgcatct
aaccgtggagcagataatatcgcagtatttgcggtggatcccgctactgccaagcttaca
ttaattgaatatgtatccactcgtggagggcatcctcgacacttctctttaactccggat
ggggcttatctgattgttgcgaatcgtgacgctaataacttggttgtattctctattgaa
gcagctagtggtcgtctcgtatttactggaaatacagccgaggtatctaagccggtatgt
gtgaagcctgtgattttccctgtataa

DBGET integrated database retrieval system