KEGG   Paenibacillus sp. FSL R5-0345: R50345_16920
Entry
R50345_16920      CDS       T03333                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
paef  Paenibacillus sp. FSL R5-0345
Pathway
paef00010  Glycolysis / Gluconeogenesis
paef00020  Citrate cycle (TCA cycle)
paef00260  Glycine, serine and threonine metabolism
paef00280  Valine, leucine and isoleucine degradation
paef00310  Lysine degradation
paef00380  Tryptophan metabolism
paef00620  Pyruvate metabolism
paef00630  Glyoxylate and dicarboxylate metabolism
paef00640  Propanoate metabolism
paef01100  Metabolic pathways
paef01110  Biosynthesis of secondary metabolites
paef01120  Microbial metabolism in diverse environments
paef01200  Carbon metabolism
Module
paef_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paef_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
paef_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:paef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    R50345_16920
   00020 Citrate cycle (TCA cycle)
    R50345_16920
   00620 Pyruvate metabolism
    R50345_16920
   00630 Glyoxylate and dicarboxylate metabolism
    R50345_16920
   00640 Propanoate metabolism
    R50345_16920
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    R50345_16920
   00280 Valine, leucine and isoleucine degradation
    R50345_16920
   00310 Lysine degradation
    R50345_16920
   00380 Tryptophan metabolism
    R50345_16920
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paef04147]
    R50345_16920
Enzymes [BR:paef01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     R50345_16920
Exosome [BR:paef04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   R50345_16920
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox GIDA FAD_oxidored Pyr_redox_3 FAD_binding_3 FAD_binding_2 HI0933_like DAO NAD_binding_8 UDPG_MGDP_dh_N AlaDh_PNT_C 3HCDH_N
Other DBs
NCBI-ProteinID: AIQ36160
LinkDB
Position
complement(3721764..3723176)
AA seq 470 aa
MVVGDASLDIDTLVIGAGPGGYVAAIRAAQLGQKVLIVDKSELGGVCLNRGCIPSKALIA
AAHQFESAKHGEVFGVTAENVKVDFAKTQEFKNGVVKKMTSGVTSLMKGNKIEVFNGECM
FISDTEARVFNDHESPRYRFKHCIIATGSRPIELKPFPFGGRILSSTEALELPEIPKSMI
VIGGGYIGAELGQMYSKFGTKVTIIEGLDTVLPGFDKDMTRLVAKNMAKTGIEIVTNAKA
ESAVQNDKEVTVKYSVGGESKEVTADYLLVTVGRRPNTDGELGLDLIGLELDDRGLIKVD
HQGRTSIPNIFAIGDVVPGLALAHKASYEGKIAAEAIAGLTSVVDYKVIPAVVFTDPECS
SVGLTEKEAKDKGYKVKAGKFPFAGNGRAVSLNSPEGFIKIVANSENNLVLGAQIVGIEA
SNLIAELGLAIEMGATLEDIALTIHAHPTLGEIVMEAAELVEGHPIHVMK
NT seq 1413 nt   +upstreamnt  +downstreamnt
atggtagtaggagacgcttctctagatattgacacattggtcattggtgcaggtcctggt
gggtatgtggcggcaattcgtgccgcccagctcggccaaaaggtcctcatcgtggataaa
tcggaactcggcggtgtatgtttgaaccgtggttgtattccttctaaagcactgattgct
gctgcacatcagttcgaatctgctaagcatggtgaagttttcggtgttacagctgagaac
gttaaagtggattttgccaaaactcaagagttcaaaaacggcgtagttaagaaaatgact
agcggcgtgactagcttgatgaagggcaacaaaattgaagtatttaacggcgaatgcatg
tttatcagcgacacagaagcgcgtgtgttcaatgatcatgaatccccacgttaccgcttc
aagcactgtatcattgctacaggttcccgtccgattgaattgaaacctttcccattcggt
ggacgcattttgtcttcgactgaagctctggaacttccagaaattccaaagagcatgatc
gtaatcggtggtggttacatcggcgctgagcttggtcaaatgtactccaaatttggtact
aaagtaacaatcattgaaggattggatactgtacttccaggcttcgataaagatatgact
cgtcttgttgcgaagaacatggccaaaactggcatcgaaatcgtaactaacgctaaagct
gaaagtgctgtacagaacgacaaggaagttaccgtgaaatattctgttggtggcgaatcc
aaagaagtaactgcggattacttgcttgttactgtaggccgtcgtcctaacacagacggt
gaacttggtctggatctgatcggtctagagcttgacgatcgcggattgatcaaagttgat
caccaaggtcgcacaagcattcctaacatcttcgctatcggcgacgttgttccaggtctg
gcattggcacataaagcttcttacgaaggtaagattgccgcagaagcgattgcaggactt
acatctgttgttgactacaaagtcatcccagcagttgtgtttacagatcctgagtgctct
agcgtaggtctaacagagaaagaagcaaaagacaaaggctacaaagtgaaagctggcaag
ttcccattcgcagggaatggccgcgccgtatctttgaacagcccagaaggtttcatcaaa
attgttgctaactccgaaaacaaccttgtgcttggtgcacaaatcgttggtatcgaagct
tctaacttgatcgctgaacttggtttggcaattgaaatgggcgcaacacttgaagatatc
gctttgactattcatgcgcatccaacccttggcgaaatcgtcatggaagctgctgaactg
gttgaaggtcatcctattcacgtaatgaaataa

DBGET integrated database retrieval system