KEGG   Paenibacillus sp. FSL R5-0345: R50345_16925Help
Entry
R50345_16925      CDS       T03333                                 

Definition
(GenBank) dienelactone hydrolase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
paef  Paenibacillus sp. FSL R5-0345
Pathway
paef00010  Glycolysis / Gluconeogenesis
paef00020  Citrate cycle (TCA cycle)
paef00620  Pyruvate metabolism
paef01100  Metabolic pathways
paef01110  Biosynthesis of secondary metabolites
paef01120  Microbial metabolism in diverse environments
paef01130  Biosynthesis of antibiotics
paef01200  Carbon metabolism
Module
paef_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:paef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    R50345_16925
   00020 Citrate cycle (TCA cycle)
    R50345_16925
   00620 Pyruvate metabolism
    R50345_16925
Enzymes [BR:paef01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     R50345_16925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N ATP-synt_ab_Xtn NQRA HlyD_3 DHBP_synthase DUF4588
Motif
Other DBs
NCBI-ProteinID: AIQ36161
LinkDB All DBs
Position
complement(3723179..3724804)
Genome map
AA seq 541 aa AA seqDB search
MAKFEYRFPELGEGLHEGEIIKMHIKAGDKVTDDDIVMEVQNDKAVVEVPCPVNGTVLEV
LTKDGQVCRVGEVVAIIEAEGDVPEQEGHAAEEAPAAPAPAAPAPANAKSANFEYRFPEL
GEGLHEGEIIKMHIKAGDKVTDDDIIMEVQNDKAVVEVPCPVNGTVLEVLTKDGQVCRVG
DVVAIIAAEGDVPEQAGHAAAEADVAKGSADTTSSPASGSVSAAPAPDRDVLATPSVRKF
AREQKVDISKVNGTGKGGKITREDVEAFLKGGSVPAASATPAAAASEAPKAAKTEAKAPA
AAASGNVSLEEERVPFKGIRKAISNAMVKSAYTAPHVTIMDEVDVTELVAFRTRMKPIAE
KKGVKVTYLPFIVKALVAASRQFPALNAMIDEEAGEIVYKKYYNIGIATDTPNGLIVPVI
KDADRKSIWMIASSITDLAVRGRDGKLSANEMKGSTISISNIGSAGGMFFTPIINFPEVA
ILGTGRISEKAVVKNGEIVVAPVMALSLSFDHRIIDGATAQNFMNYIKSLLNNPELLVME
V
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaagtttgaataccgattccctgaactaggtgaaggtttgcatgaaggtgaaatc
atcaaaatgcatatcaaagccggtgacaaggtaacggatgatgatatcgtaatggaagtt
caaaatgacaaggcggtagttgaggtaccttgtccagtgaacggtactgtgttggaagtt
ctgactaaagacggtcaagtatgccgtgttggcgaagttgtagcaattatcgaagctgag
ggcgatgtacctgagcaagaaggtcatgctgctgaagaagctcctgctgcacctgcacct
gctgcaccagctcctgcgaatgctaaatcagcgaactttgaatatcggttcccagaactg
ggtgaaggtctgcatgaaggtgaaatcatcaaaatgcatatcaaagccggtgacaaagta
accgatgatgatattatcatggaagttcaaaatgacaaggcggtagttgaagttccttgt
ccagtgaacggtactgtattggaagttctgactaaagacggtcaagtatgccgggtcggc
gatgttgtagctatcattgctgcagaaggtgacgttcctgaacaagccggtcatgcagct
gcagaagcagatgtagcaaaaggcagtgcagatacaacttcttcccctgcaagcggatct
gttagtgcagcaccagctcctgaccgtgatgtattggctacacctagcgttcgcaaattt
gctcgtgagcaaaaagtggatatttctaaagtgaacggaactggaaaaggcggcaaaatc
actcgtgaagacgttgaagcattcctgaaaggcggttcagtaccagcagcatctgcaaca
ccagcagcggcagcttctgaagctcctaaggctgctaagaccgaagctaaagcaccagca
gcagcggcgagcggtaatgttagtcttgaagaagaacgtgtaccattcaagggcattcgt
aaggcgatctccaatgcaatggttaaatcggcttacactgcaccgcacgttaccattatg
gacgaagtagatgttactgaactggtagcattccgtacacgtatgaaaccaatcgctgag
aaaaaaggcgttaaggttacttaccttccgttcatcgttaaagcattggttgcagcttcc
cgtcaattcccagcactcaacgctatgattgatgaagaagcaggcgaaattgtctacaag
aaatactacaatatcggtattgctactgatacacctaacggtttgattgttccagttatc
aaagacgctgaccgtaagagcatctggatgatcgctagcagcatcactgaccttgcagtt
cgtggtcgtgacggtaaattgtctgctaacgaaatgaaaggcagcacgatctctatcagt
aacattggttctgctggcggtatgttctttactccaatcattaacttccctgaagtggct
atcctcggaactggccgtatcagtgaaaaagcagttgtgaagaatggtgaaatcgtagtt
gctcctgtaatggcgttgtcactcagctttgaccaccgtattatcgatggtgcgactgct
caaaactttatgaactacattaaatcgctgctcaataatcctgagctgctggttatggag
gtataa

DBGET integrated database retrieval system