KEGG   Paenibacillus sp. FSL R5-0345: R50345_21215
Entry
R50345_21215      CDS       T03333                                 

Definition
(GenBank) thioredoxin reductase
  KO
K21567  ferredoxin/flavodoxin---NADP+ reductase [EC:1.18.1.2 1.19.1.1]
Organism
paef  Paenibacillus sp. FSL R5-0345
Brite
KEGG Orthology (KO) [BR:paef00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    R50345_21215
Enzymes [BR:paef01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.2  ferredoxin---NADP+ reductase
     R50345_21215
  1.19  Acting on reduced flavodoxin as donor
   1.19.1  With NAD+ or NADP+ as acceptor
    1.19.1.1  flavodoxin---NADP+ reductase
     R50345_21215
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox NAD_binding_8 HI0933_like DAO FAD_oxidored Thi4 K_oxygenase FAD_binding_2 FMO-like NAD_binding_7 GIDA FAD_binding_3 Lycopene_cycl INCENP_ARK-bind
Other DBs
NCBI-ProteinID: AIQ36943
LinkDB
Position
complement(4643118..4644158)
AA seq 346 aa
MNNQLELYDVTIIGGGPAGMYTAFYSGMRDLKTKLIEAKDELGGRMLVYPEKMIWDVGGV
TPVLCRQLIDQLAQQAQTFDPTIIFGQQITHHERLEDGTYILTSATGEQHWTRTVILAIG
YGILQMAKLEIEGADRYEVTNLHYTVQELEPFRGKRVLISGGGDSAVDWANELESIAASV
TIVHRREQFGGHEKNIVRMKESSVNVRVPYAVSQLHSSNGETIDQVTISHIETGESEQYE
VDAVIVNHGLKSDFGPLREWGIDMGEWCANVSGKLETNLPGIFAAGDFVDYSSKVRLIAG
TFTDAVLALNSAKLYMDPSAPKAAYVSSHNERFKEKNKALGVVDDH
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgaacaatcaactggaattatacgatgtaacgattattggcggcggacctgctgggatg
tatacagctttttatagtggaatgagagacctaaagacgaaattgattgaagcgaaggat
gagctcgggggaagaatgctagtatatcctgagaaaatgatttgggatgtaggtggggta
acacctgtactatgtcgtcaattgatagatcagcttgctcaacaggcacagacctttgac
cctacgattatttttggacagcagatcacgcatcatgagcgtctggaagatggaacttat
attctgacctcggctacaggtgagcagcattggactcgtacggtcatcctggctattggt
tacggaattttacaaatggctaagctcgaaattgaaggtgcggaccgttatgaggtgacg
aatcttcattataccgttcaggagctagagccattccgtggtaaaagagtactgatctcc
ggcggaggagactccgcagtagactgggcgaatgaactggagtccatcgcagcaagtgta
acgattgtacaccgtcgcgaacagtttggtggtcatgagaaaaatattgtgcgaatgaag
gaatcctcagttaatgttcgcgtgccctacgcagtaagccaattacacagcagtaatggt
gagaccattgatcaggttacgattagccatatcgaaacaggtgagagtgagcagtatgag
gtagatgctgttattgttaatcatggcctgaaaagcgattttggtccgttacgggaatgg
ggcattgatatgggcgagtggtgtgcgaatgtgagcggaaagctggagacgaatcttccg
ggtatttttgcagcaggtgactttgtggattatagcagtaaggtccggttaatcgccgga
acctttaccgatgcagtgcttgcgctgaacagcgccaaactgtatatggacccctctgca
cctaaggctgcatatgtttcttctcacaatgagcggttcaaagagaagaataaggcgctt
ggcgtcgttgatgaccattaa

DBGET integrated database retrieval system