KEGG   Paenibacillus sp. FSL R5-0345: R50345_21850
Entry
R50345_21850      CDS       T03333                                 

Definition
(GenBank) nitrite reductase
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
paef  Paenibacillus sp. FSL R5-0345
Pathway
paef00910  Nitrogen metabolism
paef01100  Metabolic pathways
paef01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paef00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    R50345_21850
Enzymes [BR:paef01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     R50345_21850
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Fer2_BFD Pyr_redox Rubredoxin_C NIR_SIR_ferr Pyr_redox_3 HI0933_like 3HCDH_N GIDA DAO AlaDh_PNT_C NAD_binding_7 Trp_halogenase
Other DBs
NCBI-ProteinID: AIQ37058
LinkDB
Position
complement(4784766..4787189)
AA seq 807 aa
MTAKRENLVLVGNGMAGIGTIEQILKLGGAYDITVFGSEPHPNYNRIMLSYVLEGSKTLN
DIILNDWNWYEDNNITLHTGTTVTRIDEESKQVVADNGLSVPYDKVIIATGSNSFILPVP
GSDKEGVVGFRDISDCDAMLAAAKQYSKAAVIGGGLLGLEAAKGLVNLGMDVTVVHLMED
LMERQLDRNASSMLQAELERQGVKFAMGKQTVELTGEQRVSGLRFSDDSTLAADFVVMAV
GIKPNVTLAKESGISVKRGIVVDDYLQTSMQNVYSIGECAEHRGVCYGLVAPLFEQGMVL
AKHLCGSETKPYEGSIVSTKLKISGVDVFSAGEFLDSPEHTVISSKDEWKRTYKKILLKN
NVIVGAVLFGDVTESANLQKLVKQGAVMTDEIYTEVMGTGCCGGGAKKGASVETMADEEI
VCGCNGVTKKAIVDAVTEHGFTTVDEIKACTGATRSCGGCKPVVEQILEFVLGDSFQQAA
KQGICGCTTLSRDEIVAEITAKGLKTTKEVMNVLGWKQEEGCSKCRPAINYYLGMINPDT
HQDEKESRFVNERMGANIQKDGTYTVIPRMYGGVTTPEDLKKIADVSLKYDVKVVKVTGG
QRLDLIGVKKEDLPKVWEELDMPSGYGYAKSLRTVKTCVGSQFCRFGTQDSMGMGALMER
KYERLDFPAKFKMAVNGCPRNCAESCTKDIGIVGNDGGWEVFIGGNGGIKPRIADAFCKV
KTDEELIEVCSAVMQYYRETGNYLERTSEWVERMGLEQIQTVILNNEENRKELAARIDFA
LTQVTDPWKKILNDNSTRTALFEETRL
NT seq 2424 nt   +upstreamnt  +downstreamnt
atgacagcgaagagagaaaatttagtgttagtaggcaacggtatggcgggcataggtacg
atagagcagattttgaagctgggtggagcttatgacatcacggtctttggaagtgaacct
catcccaattacaatcggatcatgttgtcttatgttcttgaaggtagcaaaacccttaat
gatatcatcctaaacgactggaattggtatgaagacaataatattaccctgcacacgggt
actacagtgacacgaattgatgaagagtccaaacaagttgttgcagataacgggttgtca
gtgccatacgacaaagtaattattgcgacaggctcgaattcttttattttacctgtgcct
ggcagtgataaagagggcgtggttgggtttcgagatatttccgactgtgatgcgatgctg
gcagcggccaaacaatatagtaaagcggctgtaatcggcgggggattgcttgggctggaa
gcagcaaaaggtcttgtgaacctaggtatggacgttactgtagttcatttaatggaagac
ctgatggagcgccagcttgatcggaatgcctcctcgatgctgcaagctgagctagagcgt
caaggtgtgaaatttgctatgggcaaacaaacggtagaattgaccggggaacagagagta
agtggattgcggttcagtgatgacagtacgcttgctgcagattttgtggtaatggccgtc
ggaattaaaccgaatgtaacgttggcaaaagaaagcggaatctccgtaaaacgtgggatc
gtagtggatgattatctgcaaacctccatgcagaacgtatattccatcggcgaatgtgcc
gagcatcgtggagtgtgttacggactggtggccccgctatttgagcaaggcatggttcta
gctaaacatttatgtggtagtgaaacgaagccttatgaaggttccattgtttccacgaag
cttaaaatatctggggtggatgtattttctgcaggtgagtttttggattctcctgaacac
acggtgatctcaagcaaagatgaatggaagagaacctataagaaaattttgctcaaaaat
aatgtaattgtcggtgcggtcttgttcggtgatgtgacggagtccgcgaatctgcaaaag
ttagtaaaacaaggcgcggtaatgaccgatgaaatttatacagaggtcatgggaacggga
tgctgcggtgggggagctaagaagggtgcttccgtagagacgatggcggacgaagaaatt
gtctgcggttgtaacggtgtaactaaaaaagcgatcgtagatgccgtcaccgaacatggt
tttactactgtggatgagattaaagcttgcactggcgctactcgctcttgtgggggttgc
aaacccgtagtagaacaaatcctggaatttgtcttgggtgacagtttccagcaagctgcc
aagcaaggtatttgtggctgtacaacgcttagccgtgatgagattgttgctgaaatcaca
gctaaaggtcttaaaacaacaaaagaggtcatgaatgtactcggttggaaacaagaggaa
ggctgctccaagtgtcgtccggcgattaactattatctagggatgatcaaccctgatact
catcaagatgagaaagaatcccgatttgtaaatgaaagaatgggtgccaatattcaaaag
gatggaacctacactgtaataccacgcatgtacggcggggtaacaacaccagaggatctg
aagaaaatcgccgatgtctcgcttaaatatgatgtgaaagttgtgaaggtgactggcggg
caacgcctggatctgatcggtgtgaaaaaagaggatttacctaaggtatgggaagagctg
gatatgccttcaggttacggttatgccaaatctcttcgtacggttaagacttgtgtgggc
tcgcagttctgccgttttggcacacaagattcgatgggaatgggcgctcttatggagcgt
aagtatgagcgtcttgattttccggcgaagtttaaaatggctgttaacggttgtcctcgt
aattgtgcagaatcctgcacgaaggatatcggtatcgtcggtaatgatggcggttgggaa
gtatttatcggtggtaacggcggtattaaaccgcgaatagcggacgccttctgcaaggtg
aagaccgatgaagagttaattgaagtgtgctcggctgtgatgcaatactaccgtgaaacc
ggaaattatttggagagaacctccgaatgggttgaacgtatggggctagaacagattcaa
acggtcattctcaacaatgaagagaatcgtaaagagcttgcggcgcggattgattttgcc
ttaactcaggtcacagatccttggaaaaaaatactgaatgacaacagcacacgtactgca
ctttttgaagaaacaagactttaa

DBGET integrated database retrieval system