KEGG   Paenibacillus sp. FSL R5-0345: R50345_26490Help
Entry
R50345_26490      CDS       T03333                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
paef  Paenibacillus sp. FSL R5-0345
Pathway
paef00970  Aminoacyl-tRNA biosynthesis
paef01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paef00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    R50345_26490
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:paef03029]
    R50345_26490
Enzymes [BR:paef01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     R50345_26490
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     R50345_26490
Mitochondrial biogenesis [BR:paef03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    R50345_26490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AIQ37839
LinkDB All DBs
Position
complement(5853793..5855238)
Genome map
AA seq 481 aa AA seqDB search
MELLMSKYETVIGLEVHVELHTNSKIFCGCSTEFGAPPNTHTCPVCLGHPGVLPVLNKQA
VNYAMKAAMALNCTIGDVSKFDRKNYFYPDSPKAYQISQFDQPIGLNGWIDIEVNGETKR
IGITRLHLEEDAGKLTHVDGGFASLVDFNRVGTPLIEIVSEPDLRSPEEARAYLEKIRAI
MQYCDVSDVKMEEGSMRCDANISLRPEGQEEFGIRAELKNMNSFRGVLRGLEYEQYRQAE
ILDDGGVVVQETRRWDEAQGKTLSMRGKEEAHDYRYFPDPDLIVLHIDDAWKESIRSTIP
ELPDARQARYSEELGLTAYDAGVITSSKPLADFFEGCLAYTQDAKAVANWIMGDLLAYLN
SNNLELSQVKITPQGLGEMIGLIAGGTISSKIAKTVFKEMLESGKLPAAIVEEKGLVQIS
DEGAIKGIVEAVVAANPQSVEDYKAGKQKAIGFLVGQVMKESKGKANPGLANKLLIEVLG
N
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggaattacttatgtctaaatacgaaacggtcatcggcttagaggttcacgtagagctt
cataccaactccaaaatcttttgcggatgctccactgaatttggagccccgcctaacacg
catacctgtcccgtctgcctgggtcaccccggcgtattgccagtactcaacaaacaagcg
gtaaattacgctatgaaagcagcgatggcgctgaattgcaccatcggtgatgttagtaaa
ttcgaccgtaagaactatttttacccggattctccgaaagcctatcagatttcgcagttc
gatcagcctatcggtttgaacggctggatcgacattgaagtgaatggagaaacaaaacgg
attggtattactcgacttcatttggaagaggatgcaggtaagctgacacacgtagatggt
gggtttgcgtctcttgtcgattttaaccgggtgggaacaccgcttatcgaaatcgtatcc
gagccagacttacgctccccagaagaagcccgtgcttatctggagaaaatccgtgcgatc
atgcagtattgtgatgtgtctgatgtaaagatggaagaaggctcgatgcgctgcgacgcg
aacatcagtctacgcccagaaggacaagaggaattcggcattagagcagagcttaagaac
atgaactccttccgtggtgtgctgcgtggactggagtatgaacaatatcgtcaggctgag
atcctggatgatggtggagtagttgtgcaagagactcgtcgctgggatgaagcgcaagga
aaaactttatctatgcgtggtaaagaagaagcacacgattatcgttatttcccagatccg
gatttgatcgtactgcatattgacgatgcctggaaagaatccattcgctcgacgatcccg
gaactgccggacgcaagacaagctcgctatagtgaagaactgggccttacagcttatgat
gctggtgtgattacgtcctctaaaccgttagcggactttttcgaaggctgccttgcttat
acgcaggatgccaaggctgttgcaaactggatcatgggtgatctgctggcttatttgaat
agtaataacctggaattgtctcaggtcaagattacgccgcaagggctcggggaaatgatc
ggccttattgcaggcggaaccatcagcagtaagatcgctaaaacggtatttaaagaaatg
ctagagagcggtaaactgcctgcagcaatcgttgaggaaaagggtctggtacaaatcagc
gatgaaggtgccattaaaggaattgtggaagctgtcgtagctgctaacccgcaatctgtt
gaggattataaagcaggaaaacagaaagccattggcttccttgtaggacaagtaatgaag
gaaagtaaaggcaaggctaatccaggtctagcgaataaacttctgatcgaggtattgggc
aactaa

DBGET integrated database retrieval system