KEGG   Paenibacillus sp. FSL R5-0345: R50345_27135Help
Entry
R50345_27135      CDS       T03333                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
paef  Paenibacillus sp. FSL R5-0345
Brite
KEGG Orthology (KO) [BR:paef00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    R50345_27135
Enzymes [BR:paef01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     R50345_27135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA Thioredoxin_3 FAD_oxidored DAO HI0933_like FAD_binding_3 Thi4 AlaDh_PNT_C K_oxygenase NAD_binding_8 Glutaredoxin Nitrate_red_del
Motif
Other DBs
NCBI-ProteinID: AIQ37963
LinkDB All DBs
Position
complement(5992811..5994340)
Genome map
AA seq 509 aa AA seqDB search
MKLDQEIKAQLAQYLELLEGDVVLKISAGSDEASQEMEALVDEIAKMSARITVEKTELPR
TPSFSVNRVGEDTGVTFAGTPLGHEFTSLVLALLQVSGRAPKVEQSVIDQIKSISGEYKF
ETYVSLSCHNCPDVVQALNLMSIFNPGITHTMIDGGVFKEEVERKEIMSVPSVYLNGEFF
ESGRMTVEEILAKMGSTVDASEFDNKAPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
LGGQVNDTLGIENFISVNYIEGPQLVAKLEEQVKEYGIDVMKLQRATRLDKNDLIEVELE
NGAVLKSKTVILSTGARWRNMGVPGEAEFKNKGVAYCPHCDGPLFTGKDVAVVGGGNSGI
EAAIDLAGIVKHVTVLEFAPELKADAVLQDRLYSLPNVTVLKNVQTKEITGTDKVDGISY
IDRATEETHHIELQGVFVQIGLVPNTDWLGDMVERTRVGEIVVDSHGATNVPGVFAAGDC
TNSAYKQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagatcaagaaatcaaagctcaactagctcaatacctagaactcttggaaggc
gacgtagtactgaaaatcagtgcaggctctgacgaagcatctcaagagatggaagcgctg
gttgatgaaattgccaaaatgtcagctaggatcacggtagaaaaaaccgaactgcctaga
accccaagctttagcgtaaatcgtgtgggtgaagatacaggcgttacctttgctggaact
ccgctaggacatgagtttacttcattagtgttggctctattgcaagttagcggaagagca
cctaaggttgagcaaagtgttattgatcagatcaagagcattagtggcgaatataagttt
gaaacttatgtcagcctaagctgtcataattgccctgatgttgtacaagcactgaaccta
atgagtatcttcaatcctggcattacccatactatgattgacggcggagtgttcaaagaa
gaggtagaacgcaaagaaattatgtctgttccaagcgtttaccttaacggtgaatttttc
gaaagcggtcgtatgacggttgaagaaattctggctaaaatgggtagtactgtggatgca
tcagagtttgacaacaaagctccttatgatgtacttgttgttggcggtggcccagcaggt
gcaagtgcagcaatttatgcggcacgtaaagggattcgcacagggattgtcgctgaacgc
ttaggcggtcaggtcaacgatacccttggcattgagaactttatcagtgttaattacatt
gaaggtcctcagctagtggctaaacttgaagagcaagtgaaagagtacggtattgatgtg
atgaagttacaacgtgccacacgtttagataagaatgatttaattgaagttgagctcgag
aacggtgctgttctaaagagtaagacggtcatcctgtcgacaggtgctcgttggcgcaat
atgggtgtgcctggtgaagctgaattcaagaataaaggcgtagcctactgcccacactgt
gacggtcctttatttacaggcaaagatgttgccgttgtcggcggcggtaattcagggatt
gaagcagcgattgaccttgcgggtatagtgaagcatgtaacggttctggagtttgctcca
gagctcaaagcggatgctgtactgcaagatcgtctctacagcctacctaacgttactgtg
cttaagaacgtgcaaacgaaagaaattactggaacggataaggtagatggtatttcttat
atcgatcgtgcgacagaagaaactcaccatattgaattacagggtgtgtttgtacagatc
ggtttggttccgaacacagattggttaggtgacatggttgaacgtactcgcgttggcgag
atcgttgtagatagccatggtgccacaaatgtaccaggagtatttgctgctggcgattgc
actaatagtgcttataaacaaatcatcatttcgatgggatcaggtgcaacagcagcttta
ggtgcatttgattatctgatccgtaactaa

DBGET integrated database retrieval system