KEGG   Paenibacillus sp. FSL R5-0345: R50345_27190
Entry
R50345_27190      CDS       T03333                                 

Definition
(GenBank) pyridine nucleotide-disulfide oxidoreductase
Organism
paef  Paenibacillus sp. FSL R5-0345
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 FAD_binding_2 HI0933_like DAO FAD_binding_3 GIDA NAD_binding_8 Thi4 Pyr_redox Lycopene_cycl AlaDh_PNT_C FAD_oxidored NAD_binding_7
Other DBs
NCBI-ProteinID: AIQ37973
LinkDB
Position
complement(6006182..6007093)
AA seq 303 aa
MKMNYDCAIIGGGPAGLNAALVLGRARKNVVVIDEGRARNRVTRETHGFLTRDPISPSDF
RRIAKEQISAYPSVTFAEDTAISITGTDGDFQISTVQGQTYRSKKLLFAIGMKDLPMEIK
GLSDVYGKSAFICPYCDGWELRDQPLVVIVKGADATHMAQVISGWTNNITICTNGSDDLT
NAQCEELQQHNIPVYDLPIQSIESDNGMVQQVMLKDGTSIVCTGIFFRPKLMIGSDLPQA
IGCEITEAGTVIVDNLGKTNVPGVYSAGDAATHLHQAIIAASMGSLAGVGINNELNEEEW
RNI
NT seq 912 nt   +upstreamnt  +downstreamnt
atgaaaatgaattacgattgtgcgattatcggcggaggaccggcaggtctcaatgctgct
ttggtgctaggcagggcaagaaaaaacgttgttgttattgatgaaggacgcgcccggaat
agggttactcgagaaacacatggctttcttactagagatcctataagtccaagcgatttt
agacgaattgcgaaggagcagataagtgcctatccatccgttacttttgcggaagatacc
gctatatcgattacgggaaccgatggtgattttcaaatttcgactgttcagggtcagacc
tatcgaagtaaaaagctgctctttgcgataggaatgaaggatcttccgatggaaattaag
gggctctcagatgtgtatggcaaaagcgcctttatctgcccttattgtgatggatgggag
ctaagagatcagcctcttgtagtaattgttaagggagccgatgcaacgcatatggcccaa
gtgatatctggttggacgaataacattaccatatgtactaatggatctgatgacttgacg
aatgcacaatgcgaggaacttcaacaacataacattccggtctatgatttgccgattcaa
tcgatcgaatctgacaatggtatggtacagcaagttatgctgaaggatggtactagcatc
gtatgtacagggatatttttcagaccaaagctaatgatcggatcagatttgccgcaagcc
atcggttgcgagatcacagaagctggaacagttattgtcgataatctcggtaaaacgaac
gttccaggcgtttatagtgccggtgatgcagcaacacatcttcatcaagccattattgcc
gcttctatgggttccttagctggggtgggcattaacaacgaactaaatgaagaggaatgg
cgtaacatctga

DBGET integrated database retrieval system