KEGG   Paenibacillus sp. FSL R5-0345: R50345_29020
Entry
R50345_29020      CDS       T03333                                 

Definition
(GenBank) NADH oxidase
Organism
paef  Paenibacillus sp. FSL R5-0345
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_dim Pyr_redox_3 DAO K_oxygenase UDPG_MGDP_dh_N 3HCDH_N Amino_oxidase TrkA_N AlaDh_PNT_C NAD_binding_7 XdhC_C
Other DBs
NCBI-ProteinID: AIQ38293
LinkDB
Position
complement(6389587..6390951)
AA seq 454 aa
MKIAVIGCTHAGTAAIVNTAQLYPEAEITVYERNDNISFLSCGIALYVGGVVKDPHGLFY
SSPEKLAELGVKTNMRHEVTEVDTKSKTLRVRNLATGQEFNDTYDKLIMTTGSWPVVPKL
EGLELEGVLLCKNYEHSNTIIEKAKHANKITVVGAGYIGVELVEAFQMNGKQVTLIDGED
RILNKYLDPEFTAPIEQSFKDHGIKLALNEKVSSFAGEGGKVTKVITSAGEHETDLVILC
IGFRPNTELLKGQVDMLPNGAILVNDYMQTSCPDVYAAGDSCAIHYNPTGKHAYIPLATN
AVRMGTLVARNLMTETIPYMGTQGTSGIKIYEDNIAATGLTEEAAKAEGMDVETTTIIDN
YRPEFMPTFEQVQLKVVFDRATRRIVGAQIMSKMDLTQSINTVSVCIQNKMTIDQLAFID
FFFQPHYNKPWNFLNTVGIQALPTSVPSKEAVTV
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgaaaatagctgtcattggatgtacccatgccggaactgccgcaattgtaaatactgcc
caactgtacccagaagctgagattacggtatatgagcgtaatgataatatttccttctta
tcctgtggcattgctttatatgtaggtggagtggtcaaagacccgcacggactgttctat
tcttccccagagaagcttgcagagctcggagtaaagacgaacatgcgtcatgaagtgacc
gaagtggatacgaagtccaaaacactgcgtgttcgcaatttggcaactggacaggagttt
aatgatacctacgataagctgattatgactactggatcatggccggttgtgccgaagctc
gaagggcttgagctggaaggcgtcttgctttgcaagaattatgaacattccaacaccatt
atagaaaaagctaaacatgcgaacaaaatcacagtcgtaggcgctggctatatcggcgtt
gaattggtggaagccttccaaatgaatgggaagcaagtaacgctgattgatggtgaagac
cgcattctgaataaatatttggatccagagtttactgcaccaatcgaacaatcctttaag
gatcacggcattaaattggcactgaatgagaaggtcagttcttttgctggagaaggcggt
aaagttaccaaggttatcacaagcgcaggagagcatgagacggatcttgttattctctgc
atcggcttccgtccgaatactgaactcttaaaaggccaggtggatatgctgccaaatggt
gcgattttggtcaacgactatatgcagactagttgcccagatgtgtatgccgctggtgac
agctgtgcgattcattacaaccctacagggaagcacgcttatattccactagcaaccaac
gcagtacggatgggcaccttggtcgcacgtaacttgatgacagagacgattccatatatg
ggcactcaagggacttcgggcattaagatttatgaagataatatcgctgctaccggtctt
acagaagaagcggctaaggctgaaggcatggacgtagagactaccacgattattgacaac
taccgtccagaatttatgccaacgttcgaacaggttcaattaaaagttgtatttgatcgt
gctacacgccgcattgtcggagcacaaattatgtccaagatggatttgacgcaatcgatc
aacaccgtatctgtatgtattcaaaataaaatgacaatcgaccagctggcctttatcgat
ttcttcttccaacctcattacaataagccttggaacttcctgaacaccgtaggaattcaa
gcgctgccgacatcagtaccaagtaaagaggcagtaaccgtttaa

DBGET integrated database retrieval system