KEGG   Paenibacillus sp. FSL R5-0345: R50345_29310
Entry
R50345_29310      CDS       T03333                                 

Definition
(GenBank) dihydropyrimidine dehydrogenase
  KO
K17722  dihydropyrimidine dehydrogenase (NAD+) subunit PreT [EC:1.3.1.1]
Organism
paef  Paenibacillus sp. FSL R5-0345
Pathway
paef00240  Pyrimidine metabolism
paef00410  beta-Alanine metabolism
paef00770  Pantothenate and CoA biosynthesis
paef01100  Metabolic pathways
Module
paef_M00046  Pyrimidine degradation, uracil => beta-alanine, thymine => 3-aminoisobutanoate
Brite
KEGG Orthology (KO) [BR:paef00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    R50345_29310
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    R50345_29310
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    R50345_29310
Enzymes [BR:paef01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.1  dihydropyrimidine dehydrogenase (NAD+)
     R50345_29310
SSDB
Motif
Pfam: Fer4_20 Pyr_redox_2 Pyr_redox_3 Pyr_redox DAO FAD_oxidored NAD_binding_8 AlaDh_PNT_C FAD_binding_3 GIDA HI0933_like NAD_binding_7 Amino_oxidase Thi4 2-Hacid_dh_C FAD_binding_2 Lycopene_cycl FMO-like 3HCDH_N IlvN Fer4_7
Other DBs
NCBI-ProteinID: AIQ38345
LinkDB
Position
complement(6457132..6458484)
AA seq 450 aa
MFMRNFAEAEPPLTHKGAMDEANRCLYCYDAPCIKACPTSINIPSFIKRIATDNLKGSAQ
TIMDSNPVGASCARVCPTDELCEGACVLNDASAPIQIGLLQRYATDWAMNSGVQLFKAGI
PNGKKVAVIGGGPAGLSAARELAREGCAVVIYEAKELAGGLDTHGIVSFRLPQAISLWEV
EQVEKLGVEIRTGVKVGVDVSVEELKSNYDAIVLAAGMGYVPPIGIEGEKLAGVYDAIAL
VESTKTGIPLLELMGQRVAVIGAGNTAIDAATCSVRLGAANVKMVYRRTREEITAYDFEY
EFAKQEGVEFSWLTLPKRIVGDELGNVTALECVQMKLTDELGKDGRPVPIPIAGSEFLIP
VDAVVIAIGQKRRLDLIDSLGLVHDRGVVRVDEATCQTSDPQIYAAGDIIFGSGKGEAMV
VSAAQQGKDAAYAIVKQFSGQQEVVVRSAG
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgttcatgcgcaatttcgccgaggctgagccgcctctgacccataagggtgccatggat
gaggccaatcgctgtctatattgctacgatgccccttgtataaaagcttgtccgaccagt
ataaatattccctcttttattaaacggatcgctactgataatttgaagggctcagcacag
acgattatggattccaatcctgtgggtgccagctgtgctcgtgtttgtcctacggatgaa
ctgtgcgaaggagcttgtgtgttaaatgatgcttcggcaccgatccaaattggactgttg
cagcgttatgcgacagattgggcgatgaatagcggagttcaattatttaaagcaggtatt
cctaatggaaaaaaggtagctgtaatcggcggtggtcctgccggattgtcagcggctagg
gagctcgctcgtgaaggttgtgctgtagtgatttacgaggcgaaagagctggcaggtgga
ttggatacgcatgggattgtgtcatttcggcttccgcaggctatatcgctctgggaagtg
gagcaggtagagaagctgggtgtggaaatacgtacaggtgtaaaagttggagtagatgtc
tctgtagaagagttgaagtcgaactatgatgccatcgttttggcagcgggtatgggttat
gtacctccgatagggattgaaggtgaaaaattggctggcgtatatgatgccattgcactt
gtagaatcgactaagaccggcatccctctgctagagctgatgggtcagcgggttgctgtc
attggtgcaggcaatacagctattgatgcagctacatgctcagtacgacttggagccgct
aatgtaaaaatggtctaccgccggactcgtgaagagattacggcttacgactttgaatat
gaattcgcgaaacaagaaggtgtggagtttagttggcttaccttaccaaaacgtatcgtg
ggggatgagcttgggaatgtaaccgcactggaatgtgtgcagatgaagctgacggatgag
ctaggcaaggatggacgtccagtgcctatccctatagcgggttctgaattcttgattcct
gttgatgcggttgtaattgctattggtcaaaagcgtcgcctggatctaatagattcctta
ggccttgtgcatgaccgcggcgttgtgagggtagatgaggctacttgccaaacctccgat
ccgcaaatttatgccgctggagatatcatatttggctcaggtaaaggtgaggcgatggtg
gtatctgcagcgcagcaggggaaggacgcagcctatgcaattgtgaaacagttctcaggc
cagcaggaggttgtcgttagatctgcgggttga

DBGET integrated database retrieval system