KEGG   Paenibacillus sp. FSL R5-0345: R50345_29355Help
Entry
R50345_29355      CDS       T03333                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
paef  Paenibacillus sp. FSL R5-0345
Pathway
paef00500  Starch and sucrose metabolism
paef01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    R50345_29355
Enzymes [BR:paef01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     R50345_29355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: AIQ38354
LinkDB All DBs
Position
6469332..6470804
Genome map
AA seq 490 aa AA seqDB search
MMRNHTMMQFFEWHVAADGKHWDRLKETASALKAVGIDSVWVPPVTKAVSADDTGYGVYD
LYDLGEYDQKGTVRTKYGTKQALIEAISECQKNGIAVYVDLVMNHKAGADEKEVFQVIEV
DPNDRMKEISKPFEIEGWTKFTFPGRGDEHSSFKWNHNHFNGTDFDAKSGRTGVFRIAGE
NKTWNQNVDDEFGNYDYLMFANIDYSHPEVKKEMIQWGKWLVDTLHCSGFRLDAIKHINH
EFVKEFAVEMFNKCEKDFYIVGEFWNSDLESCRQFLNTVDYKIDLFDVSLHYKLHSASLG
GRNFDLTKILDDTLVQTHPTNAVTFVDNHDSQPHEALESWVDDWFKQSAYALILLRRDGY
PVVFYGDYYGIEGPTPVAGKKAAIDPLLYTRYHKAYGEQKDYFDHPNTIGWTRLGVKEIE
HSGCAVVISNGENGQKRMFVGEQRAGEVWVDFTHNHKATITIEKEGWATFPVNGGSVSVW
ALPDAEVDEK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
ataatgaggaaccatacaatgatgcaattttttgaatggcatgtcgctgcggatgggaaa
cactgggatcgcctgaaagaaacagcttccgcactaaaagccgtaggcattgattctgtt
tgggtacctcctgtgacaaaggccgtctccgccgacgatacaggctatggcgtgtatgat
ctatacgatctgggcgaatatgaccaaaaaggtacggtacgcaccaaatatggcaccaaa
caagcactgattgaagccatttcggaatgtcaaaaaaacggcattgccgtgtacgttgat
ttggtcatgaatcacaaggcaggagcggatgaaaaggaagtcttccaggtgatcgaggtc
gaccctaatgaccggatgaaagaaatctccaagcctttcgagatagagggctggactaaa
ttcaccttccccggccgcggtgatgaacactcttcctttaaatggaatcacaatcatttt
aacggcactgactttgacgccaaatcggggcgaacaggtgtattccgtatcgcaggcgag
aataaaacatggaaccagaatgtggacgacgagttcggcaactacgattatctgatgttc
gcaaatattgattacagtcatccagaagtcaaaaaagaaatgatccaatggggaaaatgg
ctggtggacacgcttcactgcagcggctttcgtttagatgccatcaagcatatcaatcat
gagtttgtgaaagaattcgcggtcgaaatgtttaataaatgtgagaaggatttctatatc
gtgggcgagttctggaattcggatttagaatcctgccggcaatttctaaataccgtcgac
tataagatcgacctcttcgatgtctcccttcactacaagttgcattcagcttccttgggg
ggtagaaactttgatttaaccaaaatcctcgacgacacactagtgcagacccatcctacc
aatgccgtaacgttcgtggacaatcatgattctcagccccatgaggctcttgaatcgtgg
gtagatgactggttcaagcaaagtgcttatgcgcttatcctgctgcgacgcgatggatat
cctgtggtcttttatggagattattatgggatcgagggacctacacctgtggcaggcaaa
aaagcggcgattgatccactactatatacccgctaccacaaggcttacggtgaacagaag
gattacttcgatcacccgaacacgattggttggacccgcctcggggtgaaggagattgaa
cactctggatgcgcggttgtaatcagtaacggtgagaacggtcagaaaagaatgttcgta
ggggaacaacgtgccggtgaagtatgggtagactttactcataatcacaaggcgaccata
acgattgaaaaagagggctgggcgaccttcccggtcaacggtggcagcgtatctgtctgg
gctctgcctgatgcagaagtcgacgaaaaataa

DBGET integrated database retrieval system