KEGG   Pseudomonas aeruginosa YL84: AI22_00095Help
Entry
AI22_00095        CDS       T03035                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
paeg  Pseudomonas aeruginosa YL84
Pathway
paeg00473  D-Alanine metabolism
paeg00550  Peptidoglycan biosynthesis
paeg01100  Metabolic pathways
paeg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:paeg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AI22_00095
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AI22_00095
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    AI22_00095
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:paeg01011]
    AI22_00095
Enzymes [BR:paeg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AI22_00095
Peptidoglycan biosynthesis and degradation proteins [BR:paeg01011]
 Precursor biosynthesis
  Amino acid ligase
   AI22_00095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_YheCD GARS_A ATPgrasp_ST ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AHH47283
LinkDB All DBs
Position
complement(21883..22908)
Genome map
AA seq 341 aa AA seqDB search
MKVAVLFGGSSEERDVSIASGAQVIQALRSAGHQVLAVDTASGLLGAEEERHLLASKVKE
VPPDSDSLAIIRSGKQSLLSAGELAGVDVFFLALHGGTGEDGTLQALLDAGGFAYTGSGH
LASAMAMDKDVAKRLFLAAGVETASWLMAPASEEAVREQLGFPLVVKPNSQGSTVGLSIV
HSQAELQPAIELAGRYGDEVMLERFVAGREVTVGVLDDQALPVGEILLGGQEVFDYEHKY
QAGAVREVFPADLPPAIAAEAQRLALKVHRALKLSGYSRTDFRLDEQGRLWCLEVNTLPG
MTATSLLPQAAAAAGIGFAELCERICRLGIERCKGARKARS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggtcgccgttctcttcggcggcagcagtgaggaacgggacgtctccatcgccagc
ggcgcgcaggtgatccaggcgttgcgcagcgccggccaccaggtgctggcggtggatacc
gccagcggcctgctcggcgcggaggaagagcgccacctgctggcgagcaaggtcaaggag
gtcccgccggactccgactcgctggcgatcatccgcagcggcaagcagagcctgctgagc
gccggcgaactggctggggtcgacgtgttcttcctcgccctgcacggcggcaccggcgag
gacggcaccctgcaggcgctgctggatgccggtggtttcgcctataccggcagcggccac
ctggccagcgccatggcgatggacaaggacgtggccaagcgcctgttcctcgccgccggg
gtggagaccgccagttggctgatggcgccggcctcggaagaggcggtgcgcgagcaactg
ggcttccccctggtggtcaagccgaacagccagggctccaccgtggggctgtccatcgtg
cattcccaggccgaattgcagccggccatcgagctggccgggcgctatggcgacgaggtg
atgctggagcgcttcgtcgccggccgcgaggtcaccgtcggggtgctcgacgaccaggcg
ctgccggtgggcgagattctcctcggcggccaggaggtcttcgactacgagcacaagtac
caggccggcgcggtgcgcgaggtgtttcccgccgacctgccgccggcgatcgccgccgag
gcccagcgtctggcgctgaaggtacaccgggcgctgaagctgagcggctacagccgcacc
gacttccgcctcgacgaacagggccggctctggtgcctggaggtcaataccctgccgggc
atgaccgccaccagcctgctgccgcaggccgcggcggcggccgggatcggtttcgccgaa
ctctgcgagcggatctgccggctcggcatcgagcgctgcaagggcgcgcgcaaggcgcgt
tcctga

DBGET integrated database retrieval system