KEGG   Pseudomonas aeruginosa YL84: AI22_03515Help
Entry
AI22_03515        CDS       T03035                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K11912  serine/threonine-protein kinase PpkA [EC:2.7.11.1]
Organism
paeg  Pseudomonas aeruginosa YL84
Pathway
paeg02025  Biofilm formation - Pseudomonas aeruginosa
paeg03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:paeg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AI22_03515
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    AI22_03515
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:paeg01001]
    AI22_03515
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paeg02044]
    AI22_03515
Enzymes [BR:paeg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AI22_03515
Protein kinases [BR:paeg01001]
 Serine/threonine kinases: Other
  Bacterial family
   AI22_03515
Secretion system [BR:paeg02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   AI22_03515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TssR VWA APH VWA_2 Pkinase_fungal Kinase-like Kdo
Motif
Other DBs
NCBI-ProteinID: AHH47946
LinkDB All DBs
Position
735834..738923
Genome map
AA seq 1029 aa AA seqDB search
MDIELPGFDIERELGEGAMATVYLATQRSLQRKVALKVMAAALAADPSFAERFLREGRTL
ARLSHPNTVTIHDIGNVGSCYYMAMEYLPNGTLKERIQQGLDPELGLVYVRQVAAALGYA
HSQGLVHRDVKPANILFRADGTAVLSDFGIAKSIEDNTQFTQVGFAVGTPSYMSPEQARG
QEIDGRADLYALGVVLYEILTGKLPYNGKDSLSTALAHLTEPLPELPIEQGRYQDILRQL
LAKDPAERFPTAGALIAALDRLAPSALEATQIRPLATPQGSPRASNPPPAEPAPMPPADL
GGLQPVSIQLPPVTPSAGGATPPPPPPSQAAKPPSPPPPPAKPRAGGSRTPLIAAAAAAV
LLAIGGGAWWLLGSGDAPSAADPAPLGQTPADKPQQQTPVADAEQDGGERPLLMPGKKTL
FQRVLTKPGAAISAEAGGPPRAGAVPAFSVLYVYARKQVGGSPWLRVGASSNGEGDGWLP
ASAVSDWKQSLVLKFTERSGRAPVMFLNSAEQVERLLGDTRAARDTLTQAVDHKGDPQVV
AVEPNDRAIPQDQFYLLPIFDSKESFDADGQPAQLLEVASIDPGGSAAAPQAPGQAGQGG
ASGAASDTFRTGIVLVVDTSVSMQPYIDRVREVIDGLQRQIGERGDLDKVSFGLVGFRNN
TDKTPGLEYVSKTLVPLQPGNDAQRFAELSSQVRATDVSSHSFNEDAFAGIMQAVDEMDW
SPYAGRVVLLVTDAGALRKNDPLGRTQMNEAEVRQAALRKGVKIYALHLRTPAGKNNHGY
AEQQYRSLTADANPKIADLYIPVAGGEVNAFGNTVKEIGTVFADLVHDAGNRKPQAPRFD
AAPSVASKSAAIGYAMQMEFLGRRDPVRAPQVVTAWTADRDLTNPALPAFQVCVLLSKLQ
LNELQQSLKLIVDAAKRTQTSPKDFFQEIASASAYMSRDPAQLVKGSNLAQSGVLGEYLE
GLPYRSKSLNMTQDLWLSLSVAEQQDFIDELESKIRLYETFHNDVANWVRFGDADAGDAL
YRVPLSTLP
NT seq 3090 nt NT seq  +upstreamnt  +downstreamnt
atggacatagaacttccgggattcgacatcgaacgcgagctgggcgaaggcgccatggcc
acggtctacctggccacccagcgctcgctgcagcgcaaggtggcgctgaaggtgatggcc
gcggcgctggccgccgacccgagcttcgccgaacgcttcctgcgcgaaggtcggaccctg
gcgcggctgtcgcacccgaacacggtgaccatccacgacatcggcaacgtcggcagttgc
tactacatggccatggaatacctgcccaacggcacgctcaaggagcgcatccagcagggc
ctcgatcccgagctgggcctggtctacgtacggcaggtggccgccgcgctcggctacgcg
cactcccagggcctggtgcatcgagacgtgaagccggccaatatcctgttccgcgccgac
ggcaccgcggtgctctcggacttcggcatcgccaagtcgatcgaggacaatacccagttc
acccaggtcggcttcgccgtcggcacccccagctacatgagcccggagcaggcccgcggg
caggagatcgacggccgcgccgacctctacgcgctgggcgtggtgctctacgagatcctc
accggcaagctgccctacaacggcaaggattcgctctccaccgccctggcccacctcacc
gagccgctgccggaactgccgatcgaacagggccgctaccaggacatcctgcgccagttg
ctggccaaggacccggccgagcgcttcccaaccgccggcgcgctgatcgccgccctcgac
cgcctggcgccgagcgccctggaagccacccagatccgtccgctggcgacgccgcagggc
tcgccgcgagcgagcaacccgccgccggccgaacccgcgcccatgccgcccgccgacctc
ggcggcctgcaaccggtatcgatccagttgccgccggtcacgcccagcgccggcggcgcc
acgccgcccccgcctccgccatcgcaagcggcgaaaccgccatcgcccccgccgcctccg
gcgaagccgcgtgccggcggcagccgcacgccgctgatcgccgccgccgcggccgccgtg
ctcctggcgatcggcggcggcgcctggtggctgctgggctcgggcgacgcgccgagcgct
gccgatccagcgccgctgggacagacgccggcggacaagccgcagcagcagaccccggtg
gccgatgccgaacaggacggcggcgagcgtccgctgctgatgccaggcaagaagaccctg
ttccagcgcgtcctgaccaaacccggcgcggccatctccgccgaggctggcggcccgccc
cgggccggcgcggtgccggccttctcggtgctctacgtgtacgcccgcaagcaggtcggc
ggcagcccctggctgcgcgtcggcgcctccagcaacggcgagggcgacggctggctgccg
gccagcgcggtgagcgactggaagcagagcctggtgctgaagttcaccgaacgctccggc
cgcgcgccggtgatgttcctcaacagcgccgagcaggtcgagcgcctgctcggcgatacc
cgcgcagcgcgcgacaccctgacccaggcggtggatcacaagggcgatccgcaggtggtc
gcggtcgagcccaacgaccgggcgatcccccaggaccagttctacctgctgccgatcttc
gactcgaaggaaagcttcgacgccgacggccagccggcgcagttgctggaggtcgcctcg
atcgaccccggcggcagcgccgcggcaccccaggcgccgggccaggccgggcagggcggc
gccagcggcgcggcgagcgacaccttccgcaccggcatcgtcctggtggtggacacctcg
gtgtcgatgcagccctacatcgaccgcgtgcgcgaggtgatcgacggcctgcagcggcag
atcggcgagcgcggcgacctggacaaggtcagcttcggcctggtcggtttccgcaacaac
accgacaagacccccggcctggaatacgtcagcaagaccctggtgccgctgcaaccgggc
aacgacgcgcagcgcttcgccgagttgagcagccaggtgcgcgccaccgacgtctccagc
cactcgttcaacgaagacgccttcgccgggatcatgcaggcggtcgacgaaatggactgg
tcgccctacgccgggcgcgtggtgctgctggtcaccgacgccggcgcgctgcgcaagaac
gacccgctcgggcgcacccagatgaacgaggccgaggtccgccaggcggcgctgcgcaag
ggcgtgaagatctatgccctgcacctgcgcaccccggccgggaagaacaaccacggctac
gccgagcagcagtaccgcagcctcaccgccgacgccaacccgaagatcgccgacctctac
atcccggtggccggcggcgaggtgaacgccttcggcaacacggtgaaggagatcggcacg
gtgttcgccgacctggtccacgacgccggcaaccgcaagccgcaggcgccgcgcttcgac
gccgcgccaagcgtggcgagcaagtcggcggccatcggctacgccatgcagatggaattc
ctcggtcgccgcgacccggtgcgcgcgccgcaggtcgtcaccgcctggaccgccgaccgt
gacctgaccaacccggcgctgccggcgttccaggtctgcgtgctgctgagcaagctgcaa
ctcaacgaactgcaacagtcgctgaaactgatcgtcgacgcggccaagcgtacccagacc
tcgcccaaggacttcttccaggaaatcgccagcgccagtgcctacatgagccgcgacccg
gcgcaactggtgaagggcagcaacctggcacagagcggcgtgctcggcgaatacctggaa
ggcctgccgtaccgcagcaagtcgctgaacatgacccaggacctctggctgtcgctgagc
gtcgccgaacagcaggacttcatcgacgaactggagtcgaagatccgcctctacgaaacc
ttccacaacgacgtcgccaactgggtccggttcggcgacgccgacgccggcgacgcgctg
taccgcgtgccgctgtcgacgctgccatga

DBGET integrated database retrieval system