KEGG   Pseudomonas aeruginosa YL84: AI22_04695Help
Entry
AI22_04695        CDS       T03035                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
paeg  Pseudomonas aeruginosa YL84
Pathway
paeg00010  Glycolysis / Gluconeogenesis
paeg01100  Metabolic pathways
paeg01110  Biosynthesis of secondary metabolites
paeg01120  Microbial metabolism in diverse environments
paeg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:paeg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AI22_04695
Enzymes [BR:paeg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     AI22_04695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AHH48178
LinkDB All DBs
Position
complement(998841..999758)
Genome map
AA seq 305 aa AA seqDB search
MNTDSPINRVEQVQVDDLACWRIHTAHGEALIAQQGAQLLSYQPHEQPPLVWLSDEAGYR
RGQSVRGGVPVCWPWFGPLERNPQEVRGQVEDGLKAPAHGLVRAVDWEIDDIAEEDGDLC
VSFRLDAPDGLPGWPHPAALRMLFRFGERLTLRLTSENLGSKPLVLSQALHTYFAVSDSR
EIAIEGLEGARYIETLENWEERTQHGAVRVKGELDRIYLGLERDLLIKDPRWERSIHLHA
LDSRSAVVWNPWVDKSRRLSQFADDAWQQMLCIETGRVWDDLMVVAPGRSESFGVQIWSE
PLKRP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgatagcccgatcaaccgcgtcgaacaggtacaggtcgacgacctggcctgc
tggcgcatccacaccgcccatggcgaggcgctgatcgcccagcagggcgcgcaactgctc
agctaccagccccacgaacagccgccgctggtctggctcagcgacgaggccggctaccgg
cgcgggcagtcggtacgcggcggggtgccggtgtgctggccgtggttcggtccgctggag
cgcaacccgcaggaagtccgcggccaggtggaagatggcctgaaggcgcccgcccacggg
ctggtccgggcagtcgactgggaaatcgacgacatcgccgaggaggacggcgacctctgc
gtcagcttccgcctcgacgcccccgatggcctccccggctggccgcacccggcggcgctg
cgcatgctgttccgcttcggcgagcgcctgaccctgcgactcaccagcgagaacctcggc
agcaagccgctggtgctcagccaggcactgcacacctacttcgcggtcagcgacagccgc
gagatcgccatcgagggcctggaaggcgcgcgctacatcgagaccctggagaactgggaa
gaacgcactcagcacggcgcggtacgggtcaagggcgaactggatcgcatctacctcggt
ctcgaacgcgacctgctgatcaaggacccgcgctgggaacgcagcatccacctgcacgcc
ctcgactcgcgctcggcggtggtctggaacccctgggtggacaagtcccggcgtctctcg
cagttcgccgacgacgcctggcagcagatgctctgcatcgagaccgggcgggtctgggac
gacctcatggtggtcgcccccgggcgcagcgaaagctttggcgtgcagatctggagcgag
ccgctgaaacgaccctga

DBGET integrated database retrieval system