KEGG   Pseudomonas aeruginosa YL84: AI22_06800Help
Entry
AI22_06800        CDS       T03035                                 

Gene name
aceE
Definition
(GenBank) pyruvate dehydrogenase
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
paeg  Pseudomonas aeruginosa YL84
Pathway
paeg00010  Glycolysis / Gluconeogenesis
paeg00020  Citrate cycle (TCA cycle)
paeg00620  Pyruvate metabolism
paeg01100  Metabolic pathways
paeg01110  Biosynthesis of secondary metabolites
paeg01120  Microbial metabolism in diverse environments
paeg01130  Biosynthesis of antibiotics
paeg01200  Carbon metabolism
Module
paeg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:paeg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AI22_06800 (aceE)
   00020 Citrate cycle (TCA cycle)
    AI22_06800 (aceE)
   00620 Pyruvate metabolism
    AI22_06800 (aceE)
Enzymes [BR:paeg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     AI22_06800 (aceE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH_E1_M Transketolase_N Transketolase_C DUF3135
Motif
Other DBs
NCBI-ProteinID: AHH48587
LinkDB All DBs
Position
complement(1464190..1466838)
Genome map
AA seq 882 aa AA seqDB search
MQDLDPVETQEWLDALESVLDREGEDRAHYLMTRMGELASRSGTQLPYAITTPYRNTIPV
THEARMPGDLFMERRIRSLVRWNALAMVMRANKHDPDLGGHISTFASSATLYDIGFNYFF
QAPTDEHGGDLVFFQGHASPGVYARAFLEGRISEEQLENFRQEVDGNGLSSYPHPWLMPD
FWQFPTVSMGLGPIQAIYQARFMKYLESRGFIPAGKQKVWCFMGDGECDEPESLGAISLA
GREKLDNLIFVINCNLQRLDGPVRGNAKIIQELEGVFRGAEWNVNKVIWGRFWDPLFAKD
TAGLLQQRMDEVIDGEYQNYKAKDGAYVREHFFGARPELLEMVKDLSDEEIWKLNRGGHD
PYKVYAAYHQAVNHKGQPTVILAKTIKGYGTGSGEAKNIAHNVKKVDVDSLRAFRDKFDI
PVKDADLEKLPFYKPEEGSAEAKYLAERRAALGGFMPVRRQKSMSVPVPPLETLKAMLDG
SGDREISTTMAFVRIISQLVKDKELGPRIVPIVPDEARTFGMEGMFRQLGIYSSVGQLYE
PVDKDQVMFYREDKKGQILEEGINEAGAMSSWIAAGTSYSTHNQPMLPFYIFYSMFGFQR
IGDLAWAAGDSRAHGFLIGGTAGRTTLNGEGLQHEDGHSHLLASTIPNCRTYDPTYAYEL
AVIIREGSRQMIEEQQDIFYYITVMNENYVQPAMPKGAEEGIIKGMYLLEEDKKEAAHHV
QLLGSGTILREVEEAAKLLRNDFGIGADVWSVPSFNELRRDGLAVERWNRLHPGQKPKQS
YVEECLGGRRGPVIASTDYMKLYAEQIRQWVPSKEYKVLGTDGFGRSDSRKKLRNFFEVD
RHWVVLAALEALADRGDIEPKVVAEAIAKYGIDPEKRNPLDC
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacctcgatcccgtcgaaacccaggaatggctggacgccctggagtccgtactc
gaccgcgaaggtgaagaccgcgctcattacctgatgacccgcatgggcgagctggccagc
cgtagcggcacccaactgccctacgcgatcaccacgccctatcgcaacaccattccggta
acccacgaagcacgcatgcccggcgacctgttcatggaacgccggatccgctccctggtg
cgctggaacgccctggcgatggtgatgcgggcgaacaagcacgacccggacctgggcggc
cacatctccaccttcgcctcctcggcgaccctctacgacatcggcttcaactatttcttc
caggctcccaccgacgaacacggcggcgacctggtgttcttccagggccacgcgtccccc
ggcgtctacgcccgggccttcctcgaaggccgcatcagcgaggaacaactggagaacttc
cgccaggaagtggacggcaacggcctgtcctcctatccgcacccctggctgatgccagac
ttctggcagttccccaccgtatccatgggccttggcccgatccaggcgatctaccaggca
cgcttcatgaagtacctggaaagccgcggcttcatccccgccggcaagcagaaggtctgg
tgcttcatgggcgacggcgagtgcgacgagccggaatccctcggcgcgatctccctggcc
ggccgcgagaaactcgacaacctgatcttcgtcatcaactgcaacctgcagcgcctcgac
ggcccggtccgcggcaacgccaagatcatccaggagctggaaggcgtgttccgcggcgcc
gagtggaacgtcaacaaggtcatctggggtcgcttctgggacccgctgttcgccaaggac
accgccggcctgctgcaacagcgcatggacgaggtcatcgacggcgaataccagaactac
aaggcgaaagacggcgcctacgtgcgcgagcacttcttcggcgcgcgtccggaactgctg
gaaatggtcaaggacctttccgacgaggaaatctggaagctcaaccgcggcggccacgac
ccctacaaggtctatgcggcctaccaccaggcggtcaaccacaagggccagccgaccgtc
atcctggccaagaccatcaagggctacggcaccggcagcggcgaagcgaagaacatcgcg
cacaacgtgaagaaggtcgacgtcgacagcctgcgcgcgttccgcgacaagttcgacatc
ccggtcaaggacgccgacctggagaagctgccgttctacaagcctgaagaaggcagcgcc
gaggccaagtacctggccgagcgccgcgccgcgctgggcggcttcatgccggtgcgccgg
cagaagagcatgagcgtgccggttccgccgctggaaaccctgaaggccatgctcgacggc
tccggcgatcgcgagatctccaccaccatggccttcgtgcggatcatctcgcagttggtc
aaggacaaggaactcggcccgcgcatcgtcccgatcgtcccggacgaggcccgtaccttc
ggcatggaaggcatgttccgccagctcggcatctattcctcggtcggccagctctacgag
ccggtggacaaggaccaggtgatgttctaccgcgaggacaagaagggccagatcctcgag
gaaggcatcaacgaggccggcgccatgtccagctggattgccgccggtacctcctacagc
acccacaaccagccgatgctgccgttctacatcttctattcgatgttcggcttccagcgc
atcggcgacctggcctgggccgccggcgacagccgcgcgcacggcttcctgatcggcggc
accgccggtcgcaccacgctgaacggcgaaggcctgcagcacgaggacggccacagccac
ctgctggcctcgaccatcccgaactgccgcacctacgatccgacctacgcctacgaactg
gcggtgatcatccgcgaaggctcgcggcagatgatcgaagagcagcaggacatcttctac
tacatcaccgtgatgaacgagaactacgtccagccggccatgccgaagggcgcagaggaa
ggcatcatcaagggcatgtacctcctcgaggaggacaagaaggaagccgctcaccacgtg
caactgctgggctccggcaccatcctgcgcgaagtcgaggaagcggccaagctgctgcgc
aacgacttcggcatcggcgccgacgtctggagcgtgccgagcttcaacgagctgcgtcgc
gacggccttgccgtcgagcgctggaaccgcctgcatccgggccagaagccgaagcagagc
tacgtcgaggagtgcctgggcggccgtcgcggcccggtgatcgcctccaccgactacatg
aagctctacgccgagcagatccgccagtgggttccctccaaggagtacaaggtgctcggc
accgacggcttcggccgcagcgacagccgcaagaagctgcgcaacttcttcgaagtggat
cgtcactgggtggtgctggccgcgctcgaagcgctggccgatcgcggcgatatcgagccg
aaagtggtggccgaggccatcgccaagtacggtatcgatccggagaagcgcaacccgctg
gattgctaa

DBGET integrated database retrieval system