KEGG   Pseudomonas aeruginosa YL84: AI22_18760Help
Entry
AI22_18760        CDS       T03035                                 

Gene name
ligD
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
paeg  Pseudomonas aeruginosa YL84
Pathway
paeg03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:paeg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AI22_18760 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:paeg03400]
    AI22_18760 (ligD)
Enzymes [BR:paeg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AI22_18760 (ligD)
DNA repair and recombination proteins [BR:paeg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AI22_18760 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AHH50895
LinkDB All DBs
Structure
PDB: 

Position
4024015..4026537
Genome map
AA seq 840 aa AA seqDB search
MPSSKPLAEYARKRDFRQTPEPSGRKPRKDSTGLLRYCVQKHDASRLHYDFRLELDGTLK
SWAVPKGPCLDPAVKRLAVQVEDHPLDYADFEGSIPQGHYGAGDVIVWDRGAWTPLDDPR
EGLEKGHLSFALDGEKLSGRWHLIRTNLSGKQPQWFLVKAKDGEARSLDRFDVLKERPDS
VLSERTLLPRHGETATPAARPARRGKSGGKTPMPEWIAPELASLVEQPPRGEWAYELKLD
GYRLMSRIEDGHVRLLTRNGHDWTERLPHLEKALAGLGLQRSWLDGELVVLDEEGRPDFQ
ALQNAFEEGRGENILYVLFDLPYHEGEDLRDVALEERRARLEALLEGRDEDPLRFSATLA
EDPRDLLASACKLGLEGVIGKRLGSAYRSRRSNDWIKLKCQLRQEFVIVGYTEPKGSRRH
IGALLLGLYSPDEERRLRYAGKVGSGFTAASLKNVRERLKPLAVRSSPLAKVPPARETGS
VQWVRPQQLCEVSYAQMTRGGIIRQAVFHGLREDKPAREVTGERPAGPPPLRGARKAGAG
ASRAATAGVRISHPQRLIDPSIQASKLELAEFHARYADLLLRDLRERPVSLVRGPDGIGG
ELFFQKHAARLKIPGIVQLDPALDPGHPPLLQIRSAEALVGAVQMGSIEFHTWNASLANL
ERPDRFVLDLDPDPALPWKRMLEATQLSLTLLDELGLRAFLKTSGGKGMHLLVPLERRHG
WDEVKDFAQAISQHLARLMPERFSAVSGPRNRVGKIFVDYLRNSRGASTVAAYSVRAREG
LPVSVPVFREELDSLQGANQWNLRSLPQRLDELAGDDPWADYAGTRQRISAAMRRQLGRG
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcagcaagccgctcgccgagtacgcccgcaagcgcgatttccgccagaccccg
gagcccagcggccgcaagcctcgcaaggacagcaccgggctgctccgctattgcgtccag
aagcacgacgccagccgcctgcactacgacttccgcctggagctggatggcaccctgaag
agctgggcggtgcccaaggggccgtgcctcgacccggcggtgaagcggctcgcggtgcag
gttgaggaccatccgctggactatgccgatttcgaaggcagcatcccccaggggcactac
ggcgccggcgatgtcatcgtctgggaccgaggcgcctggacgcctctggacgatccgcgc
gagggcctggaaaagggccatctcagcttcgccctggatggcgagaaactctccgggcgt
tggcacctgatccgcaccaacctgagcggcaagcagccccagtggttcctggtcaaggcc
aaggacggcgaggcgcgcagcctggatcgcttcgacgtgctgaaggagcgtcccgacagc
gtgctcagcgagcgtacgctgctgccccgccatggcgaaaccgccacgcccgcggccagg
ccggcgcgacgcggcaagagcggggggaagacgccgatgcccgaatggatcgcccccgag
ctggccagcctggtcgagcagcctccgcgaggggagtgggcctacgaactcaagctggac
ggctatcggctgatgagccgcatcgaagacggccacgtgcgcctgctgacccgcaacggc
catgactggaccgaacgcctgccgcacctggagaaggccttggccgggctcggtctgcag
cgcagttggctggacggcgaactggtcgtcctcgacgaggagggtcgaccggacttccag
gccctgcagaacgccttcgaggaaggtcgcggcgagaacatcctgtacgtcctcttcgac
ctgccgtaccacgaaggcgaggatctgcgcgatgtcgccctggaggagcgccgcgcgcgc
ctggaggcgctgctggaagggcgagacgaagacccgctgcggttctccgcgacgctcgcg
gaagacccccgcgacctgctggccagcgcctgcaagctcggtctcgaaggcgtgatcggc
aagcgtctgggcagcgcctaccgttcgcgccgcagcaacgactggatcaagctgaagtgc
cagttgcgccaggagttcgtgatcgtcggctataccgagccgaagggctctcgccggcat
atcggcgccttgctgctcggcctctacagccctgacgaggagcgccggctgcgctatgcc
ggcaaggtcggcagcggcttcaccgcggccagcctgaagaacgtccgtgagcgcctgaaa
cccctcgcggtccgctccagcccattggcgaaggtgccgccggcgcgcgagaccgggtcg
gtgcagtgggtgcgcccgcaacagctgtgcgaggtttcctatgcgcagatgacccgtggc
gggatcatccgccaggcagtgttccacggcttgcgcgaagacaagccggcgcgcgaggtg
accggcgagcgtcccgccggcccgccgccgctgcgcggcgcgcgcaaggccggcgccggt
gcgtcgcgggcggccaccgccggcgtgcgcatcagccatccgcagcggctgatcgacccg
tcgatccaggccagcaagctggaactcgccgagttccatgcgcgctacgccgacctgctc
ctgcgcgacctgcgcgagcgcccggtgtcgctggtgcgcggccccgacggaatcggcggc
gaactgttcttccagaagcacgcggcgcgcctgaagatccccggcatcgtccagctcgac
ccggcgctcgatcccggtcatccgccgctgttgcagatccgcagcgccgaggcgctggtc
ggcgcggtgcagatgggcagcatcgaattccatacctggaacgccagcctggccaacctg
gagcggcccgaccgtttcgtcctcgacctcgacccggacccggcgctgccgtggaagcgc
atgctcgaagcgacccagctgagcctgacgttgctcgacgagctgggcctgcgcgccttc
ctcaagaccagcggcggcaagggcatgcacctgctggtgccgctggagcgccggcatggc
tgggacgaggtcaaggatttcgcccaggccatctcccagcacttggcgcgcctgatgccg
gagcgtttctcggcggtttccgggccgcgcaaccgggtcggcaagatcttcgtcgactac
ctgcgcaacagccgcggcgccagcaccgtggccgcctactcggtgcgcgcccgcgaaggg
ttgccggtgtcggtaccggtgttccgcgaggaactcgactcgctgcagggcgccaaccaa
tggaacctgcgcagtctgccgcagcgcctcgacgaactcgccggcgacgatccctgggcc
gactacgccggcacccgccagcgcatcagcgcggccatgcggcgccagctcgggcgcggc
tga

DBGET integrated database retrieval system