KEGG   Pseudomonas aeruginosa YL84: AI22_22595Help
Entry
AI22_22595        CDS       T03035                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
paeg  Pseudomonas aeruginosa YL84
Pathway
paeg00220  Arginine biosynthesis
paeg00250  Alanine, aspartate and glutamate metabolism
paeg00290  Valine, leucine and isoleucine biosynthesis
paeg01100  Metabolic pathways
paeg01110  Biosynthesis of secondary metabolites
paeg01130  Biosynthesis of antibiotics
paeg01210  2-Oxocarboxylic acid metabolism
paeg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:paeg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AI22_22595
   00290 Valine, leucine and isoleucine biosynthesis
    AI22_22595
   00220 Arginine biosynthesis
    AI22_22595
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:paeg01007]
    AI22_22595
Enzymes [BR:paeg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AI22_22595
    2.6.1.66  valine---pyruvate transaminase
     AI22_22595
Amino acid related enzymes [BR:paeg01007]
 Aminotransferase (transaminase)
  Class I
   AI22_22595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AHH51636
LinkDB All DBs
Position
4900213..4901424
Genome map
AA seq 403 aa AA seqDB search
MQVSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPEEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYYQQKQVEGVGIEDIYLGNGVSELIVMSMQALLNNGDE
VLIPAPDYPLWTAAVSLAGGKPVHYLCDEQANWWPDLEDIKAKITPNTRAMVIINPNNPT
GAVYSREVLEGMVELARQHNLVLFSDEIYDKILYDGAVHVSTASLAPDVLCLTFNGLSKS
YRVAGFRSGWVAISGPKQRAQSYIEGLDILANMRLCANVPAQHAIQTALGGYQSINDLVL
PPGRLLEQRNRAWELLNDIPGVSCVKPMGALYAFPRIDPKVCPIHNDEKFVLDLLLSEKL
LIVQGTAFNWPWPDHFRVVTLPRVDDLEQAILRIGSFLKGYQQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcagcaaatcgaacaagctcgccaacgtctgctatgacattcgcgggccggtg
ctcaagcacgccaaacgcctagaggaagagggtcaccgcatcctcaagctgaatatcggc
aacccggcgccgttcggtttcgaagctcccgaggaaattctccaggacgtcatccgcaac
ctgccgaccgcccagggctacagcgactccaagggcctgttcagcgcgcgcaaggcagtg
atgcagtattaccagcagaagcaggtggaaggcgtcggcatcgaggacatctacctcggc
aacggcgtgtcggaactgatcgtgatgtccatgcaggcgctgctgaacaacggcgacgag
gtgctgatccccgctcccgactacccgctgtggaccgccgccgtcagcctcgccggcggc
aagccggtgcactacctgtgcgacgagcaggccaactggtggccggacctggaagacatc
aaggcgaagatcacgccgaacaccagggcgatggtgatcatcaacccgaacaaccccacc
ggcgcggtgtattccagggaagtgctggaaggcatggtcgaactggcccgccagcacaac
ctggtgctgttctccgacgagatctacgacaagatactctacgacggcgccgtccacgtc
tccaccgcctcgctggcgccggacgtgctctgcctgaccttcaacggcctgtccaaatcc
taccgggtggccggcttccgctccggctgggtggcgatctccgggcccaagcagcgggca
cagagctatatcgaaggtctcgacatcctcgccaacatgcgcctgtgcgccaacgtcccg
gcgcagcacgcgatccagaccgccctgggcggctaccagagcatcaacgatctggtcctg
ccgccggggcgcctgctggagcagcgcaaccgcgcctgggaactgctcaacgacatcccc
ggcgtcagctgcgtgaagccgatgggcgcgctgtacgccttcccgcggatcgacccgaag
gtctgcccgatccacaacgacgaaaagttcgtcctcgacctgctgctctcggaaaaactg
ctgatcgtccagggcaccgccttcaactggccgtggcccgaccacttccgggtggtcacc
ctgccccgcgtcgacgatctggagcaggcgatcctgcgcatcggcagcttcctcaagggc
taccagcagtaa

DBGET integrated database retrieval system