KEGG   Pseudomonas aeruginosa YL84: AI22_29255Help
Entry
AI22_29255        CDS       T03035                                 

Definition
(GenBank) AraC family transcriptional regulator
Organism
paeg  Pseudomonas aeruginosa YL84
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 HTH_AraC AraC_binding_2 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AHH52919
LinkDB All DBs
Position
complement(6314107..6315066)
Genome map
AA seq 319 aa AA seqDB search
MPAHALLETRRASTQDIPLEQRLAFWEDYNASILVGLKCSSYSQAGFAATQDNLCLERLR
LARIGGNEHVVERDRSMIRAVPKESIFVSLVQGSQSFFYQDNGCNLLQPGELVIYRTDKP
YLFGFSGPMRQFIFDIPQDDFAERCLRDFKGPLKIGAESPVQRLLVRTLGERTRDFLDSP
HGEDAERYQEEAYDLLASIISDHAGEHRASALGASYLLAAKQYIQQHLDEPALSCERVAA
ATGVSSRHLARLFAQEGSSPGRYLQERRLERARQLLASPQGRRLDVAEVAYRHGFSSQAH
FARAFKARYGMTPSEARGR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcacatgccttgctcgaaacccggcgggccagcacccaggacattcccctggag
cagcggctggcgttctgggaggactacaacgcttccatcctggttggcctgaaatgttcg
tcgtattcccaggccggcttcgccgcgacccaggacaacctctgcctcgaacgcctgcgg
ctggcccgcatcggcggcaacgagcacgtggtggagcgcgaccgctcgatgatccgcgca
gtgcccaaggagtcgatcttcgtctccctggtgcagggcagccagtcgttcttctaccag
gacaacggctgcaacctcctgcaaccgggcgagctggttatctaccggaccgacaagccc
tacctgttcggtttttccggaccgatgcggcagttcatcttcgacattccccaggacgat
ttcgccgagcgctgcctgcgcgacttcaagggaccgctgaagatcggcgcggaaagcccg
gtgcagcgcctgctggtgcggaccctcggcgagcgtacccgggatttcctcgacagcccc
catggcgaggatgccgagcgctaccaggaggaagcctacgacctgctggcgagcatcatc
agcgaccatgccggcgagcaccgtgccagcgccctgggcgcgtcctacctgctggcggcc
aagcagtacatccagcagcacctcgacgaacccgccctgagctgcgagcgggtggccgcc
gccactggcgtctccagccggcacctggcgcggctgttcgcccaggaaggcagctcgccc
gggcgctacctgcaggagcggcgcctggagcgggcccgccagttgctcgcttcgccccag
ggccggcgcctggatgtcgccgaggtcgcctatcgccacggcttctccagccaggcgcat
ttcgcccgggccttcaaggcgcgctacgggatgacgccgagcgaggcgcgtggccgctag

DBGET integrated database retrieval system