KEGG   Pseudomonas aeruginosa YL84: AI22_29275Help
Entry
AI22_29275        CDS       T03035                                 

Definition
(GenBank) 2-deoxy-D-gluconate 3-dehydrogenase
Organism
paeg  Pseudomonas aeruginosa YL84
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase KR RmlD_sub_bind Oxidored_nitro GDP_Man_Dehyd DFP
Motif
Other DBs
NCBI-ProteinID: AHH52923
LinkDB All DBs
Structure
PDB: 

Position
6318318..6319043
Genome map
AA seq 241 aa AA seqDB search
MVFQHDIYAGQQVLVTGGSSGIGAAIAMQFAELGAEVVALGLDADGVHAPRHPRIRREEL
DITDSQRLQRLFEALPRLDVLVNNAGISRDREEYDLATFERVLRLNLSAAMLASQLARPL
LAQRGGSILNIASMYSTFGSADRPAYSASKGAIVQLTRSLACEYAAERIRVNAIAPGWID
TPLGAGLKADVEATHRIMQRTPLARWGEAPEVASAAAFLCGPGASFVTGAVLAVDGGYLC
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggttttccaacacgatatctacgccggccagcaggtgctggtcactggcggcagctcc
ggcatcggcgcggccatcgccatgcagttcgccgaactcggcgccgaagtcgtcgccctc
ggcctggacgccgacggcgtgcacgcaccgcgtcatccgcggattcgccgggaagaactg
gacatcaccgacagccagcgcctgcaacggctgttcgaagcgctgccgcgcctggatgtg
ctggtgaacaacgccggcatcagccgcgaccgcgaggaatacgacctggctaccttcgaa
cgggtgctgcgcctcaacctgagcgccgccatgctcgccagccaactggcccggccgctg
ctggcgcagcgcggcggcagcatcctcaacatcgcctcgatgtacagcaccttcggttcc
gccgaccgcccggcctacagcgccagcaagggcgccatcgtccagctcacccgttccctg
gcctgcgagtatgccgccgagcgcatccgggtcaacgccatcgcccccggctggatcgac
acgccgctgggcgccgggctcaaggccgacgtcgaggccacccaccggatcatgcagcgc
acgccgctggcgcgctggggcgaggcgcccgaggtggccagcgccgcggccttcctctgc
ggtcccggcgccagcttcgtcaccggcgccgtgctggcggtggacggcggctatctctgc
gcctga

DBGET integrated database retrieval system