KEGG   Paenibacillus sp. FSL H7-0357: H70357_00820Help
Entry
H70357_00820      CDS       T03358                                 

Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
paeh  Paenibacillus sp. FSL H7-0357
Pathway
paeh00340  Histidine metabolism
paeh01100  Metabolic pathways
paeh01110  Biosynthesis of secondary metabolites
paeh01230  Biosynthesis of amino acids
Module
paeh_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:paeh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    H70357_00820
Enzymes [BR:paeh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     H70357_00820
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     H70357_00820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG TSCPD
Motif
Other DBs
NCBI-ProteinID: AIQ15412
UniProt: A0A089HWJ5
LinkDB All DBs
Position
160605..161336
Genome map
AA seq 243 aa AA seqDB search
MSQEQENRTLNQQEAIEGIRWNESGLLPAVVQDAGTLEVLMFAYMNPESLRLSLESGQTW
FWSRSRSELWHKGGTSGNTQAITSIHYDCDSDTLLVKVVPEGPACHTGETSCFFREIPLN
ASAAAAAPVAKAAETEPSANLAGSGRFAVLGELERVIAEREAERPEGAYTTYLFDKGVDK
ILKKVGEEASETIIAAKNKDNAELRLEVSDLIYHLLVLLQERKLPLDEILEELSARHERP
RRD
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagaacaagagaatagaaccctgaaccaacaagaagcgatcgagggcatccgc
tggaatgaatccggtctgctccctgctgtggtgcaggatgccggcactttggaagtattg
atgtttgcctatatgaatccggagtcgctgcggctctcgctggagagcggccagacctgg
ttctggagccgttcacgcagtgaattgtggcataaagggggaacctcgggcaatacccag
gccattacctcgatccattatgattgcgacagcgatacgctgctcgtaaaggttgtaccg
gagggacccgcctgtcataccggtgaaacctcctgcttcttccgtgagattccactgaat
gcttcggcagcagcagcggcaccagtcgctaaggcagctgagacagagccttctgcaaac
cttgcagggagcgggcgttttgctgtactgggtgaactggagcgggtcattgccgagcgg
gaagccgaacgtccggagggtgcttatacgacctatctgtttgacaaaggcgtcgacaag
attctgaaaaaagtaggcgaagaggcttcggaaacgatcatcgccgccaaaaataaagac
aacgccgagctgcgccttgaggtcagcgacctgatctaccacctgctggtgctgctccag
gagcgcaagcttccgctcgatgagattctggaggaactgagcgcccgccacgaacggccg
cgccgggactaa

DBGET integrated database retrieval system