KEGG   Paenibacillus sp. FSL H7-0357: H70357_02815Help
Entry
H70357_02815      CDS       T03358                                 

Definition
(GenBank) aminotransferase
  KO
K08969  aminotransferase [EC:2.6.1.-]
Organism
paeh  Paenibacillus sp. FSL H7-0357
Pathway
paeh00270  Cysteine and methionine metabolism
paeh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paeh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    H70357_02815
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:paeh01007]
    H70357_02815
Enzymes [BR:paeh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     H70357_02815
Amino acid related enzymes [BR:paeh01007]
 Aminotransferase (transaminase)
  Class I
   H70357_02815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 ALF
Motif
Other DBs
NCBI-ProteinID: AIQ15747
UniProt: A0A089HXD8
LinkDB All DBs
Position
593634..594806
Genome map
AA seq 390 aa AA seqDB search
MNIFEPSDVLNALPKQFFAALVAKAGLVAAAGHDVIHLGQGNPDMPTPAHIVEALQAAAA
NPLNHRYPPFRGHSYLKEAAARFYKREYGVELDPQQEIAILFGGKTGLVEVVQCLLNPGD
IALVPDPGYPDYWSGIELARAVMEKMPLTAEHGFLPVYGDISPELAAKAKLMFLNYPNNP
TGAVATEDFFEQTVSFAAEHRICVVHDFAYAAIGYDGQKPRSYLQTPGAKENGIEIYTLS
KTYNMAGWRVAFAAGNASVIESLNILQDHMYVSLFGAVQEAAAAALLGPQDAVRDNLDRY
ESRRNLLIGGLRKIGWKVEAPKGSFFAWLPVPEGYTSQSFADLLLEKAHVVVAPGIGFGA
YGEGYVRVGLVSDEARLAEAVERIAGLKLF
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtgaatatttttgagccttccgatgtgctgaatgctttgcccaagcagtttttcgctgcg
ctggttgccaaggccggccttgtcgccgccgcaggacatgatgtgatccatcttggacag
gggaatcctgatatgcctacaccggcccacattgtagaagcactgcaggcggcagcggct
aacccgctgaaccacaggtatccgccgtttcgcggccacagctatctcaaggaagctgca
gccagattttataagcgggagtacggagtggagctggatccgcagcaggagatcgccatt
ctgttcggcggaaaaaccgggctggttgaagtggtgcagtgtctcctcaatccgggggat
atagcacttgtgccggatcccggatatcctgattactggtcaggcatcgagctggcccgg
gcggtcatggagaagatgccgttgactgcggaacatggatttctgcccgtttacggggac
atcagcccggagctagccgctaaggccaagctgatgttcctcaattatccgaacaatcct
accggtgcggtagctacggaggattttttcgagcagaccgtgagcttcgcggcagaacac
aggatttgtgttgtgcatgatttcgcttatgctgccatcgggtatgatggacagaagccg
cgcagctacctgcagacgccgggggccaaggagaacggcattgagatctatactttgtca
aaaacctataatatggctggctggcgtgtggcttttgctgccggtaacgccagcgttatc
gagagtctgaacatcttgcaggatcatatgtacgtgagcctgttcggggcagtgcaggaa
gcagctgcggctgcgctgctgggaccacaggatgctgtccgggataatctggaccgctac
gagtcgcggcgcaacctcttaatcggcggcttgcggaagattggctggaaggtggaggcg
cctaagggctcgttttttgcctggctgccggttccggaaggctatacctcacagagtttt
gccgatttgctgctggagaaggcgcatgtggtggtagctcccggtattggttttggcgct
tatggcgaaggttatgtgcgggttgggctggtgagcgatgaagcacggcttgcagaagcg
gtggaacggatagcgggactgaagcttttttga

DBGET integrated database retrieval system