KEGG   Paenibacillus sp. FSL H7-0357: H70357_03050Help
Entry
H70357_03050      CDS       T03358                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
paeh  Paenibacillus sp. FSL H7-0357
Brite
Enzymes [BR:paeh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     H70357_03050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF2935
Motif
Other DBs
NCBI-ProteinID: AIQ15789
UniProt: A0A089J3N9
LinkDB All DBs
Position
complement(644300..645475)
Genome map
AA seq 391 aa AA seqDB search
MLYVYGPLLPARILEETVFWKTQEKEHTEVIKAIVPHLEEPYVKLLDEWAVVFGATEQAA
RRLLETSLTPAFAGQRELAAETELLLQTVCSQSREFIRQLYALCESSKAVKAQPLAGIVL
MHIIRESEYFLAVLGGLSTPGQVSVLMRESAADPAEFASVASAEGSGNGFGPATPAAQTR
EPGSVPIGGHKLPPLPYAYNALEPYIDEKTMTIHHDKHHQSYVDGLNKAEIKLAEARKTN
DFDLVKHWERELAFNGAGHYLHTIFWNVMSPQGGGRPTGALLDAIERSFGSYDAFKAQFT
EAANKVEGGGWAILVWSPRSRRLEILTAEKHQNLSQWDVVPLLALDVWEHAYYLKHQNNR
AAYIQDWWKVVNWPYVSQRYAAARKLVWQPF
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgttatatgtatatggaccgctgctgccagcacgaatactcgaagaaactgtattttgg
aagacccaggagaaagagcataccgaagtcatcaaagcaattgtgcctcacttggaagag
ccttatgtcaaactactcgatgaatgggctgtcgtctttggtgccacagagcaagccgcg
cggcggctgctggaaacttcgctcactccggcatttgccgggcagcgtgaacttgctgcc
gaaacagagttgctgctgcagacggtctgttcccagtcgcgtgagttcatccgccagcta
tacgcactgtgcgaaagcagcaaggcggtgaaagcccagccgctggctggtattgtacta
atgcatattattcgcgagtccgagtatttccttgctgttctgggaggactgagcacgccc
ggacaggtatccgttctaatgcgggaaagcgcagccgacccagcggagtttgcgtctgta
gcttctgcagagggcagcggcaacgggtttgggccggcaaccccggcagcccaaacccgt
gaacccggttctgtgcctataggcgggcataagctgcctccgctcccttatgcttataat
gcgcttgaaccgtatatcgacgagaagaccatgaccatccatcatgacaaacatcaccaa
agctacgtagacggactgaacaaagcagaaattaagctggcggaagcccgcaaaaccaac
gatttcgatctcgtcaaacattgggaacgagagcttgcttttaatggtgccgggcattat
cttcacaccatcttctggaacgtaatgtctccacaaggcggcggacgtcctaccggcgcc
ctgctggacgccattgaacgcagcttcggtagctatgatgcctttaaagcgcaattcacc
gaagcagcgaataaggttgaaggcggtggctgggctattcttgtctggagtccgcgcagc
cgcagactggaaatcctcactgctgagaaacaccagaatttgtcgcaatgggatgttgtg
ccgctgctcgccctggatgtgtgggagcatgcctattacctcaagcatcagaacaatcgc
gccgcctatatacaagactggtggaaggtcgtcaattggccttatgtctcacagcgttat
gccgccgcccgcaagctggtctggcagcccttttga

DBGET integrated database retrieval system