KEGG   Paenibacillus sp. FSL H7-0357: H70357_03080Help
Entry
H70357_03080      CDS       T03358                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
paeh  Paenibacillus sp. FSL H7-0357
Pathway
paeh00473  D-Alanine metabolism
paeh00550  Peptidoglycan biosynthesis
paeh01100  Metabolic pathways
paeh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:paeh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    H70357_03080 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    H70357_03080 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    H70357_03080 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:paeh01011]
    H70357_03080 (ddl)
Enzymes [BR:paeh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     H70357_03080 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:paeh01011]
 Precursor biosynthesis
  Amino acid ligase
   H70357_03080 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: AIQ15794
UniProt: A0A089J3P5
LinkDB All DBs
Position
654386..655477
Genome map
AA seq 363 aa AA seqDB search
MGNTKLTVGLVYGGKSGEHEVSLQTAFAVMNAFDYDKYEIIPFYISKQGLWKVGETLTAA
YSGIEQLKLAGAAGDMGTALNAVFSGLAGGEKSIDVMFPLLHGTNGEDGTIQGLFEMANI
PYIGAGVLASSAGMDKVVMKKLFGEAGLAQCEYCYFNAAVWKHKSHELIMGVEDKLGYPV
FVKPANLGSSVGISKAVDKESLIKAVDFAFRYDTKVIIEEFVDAREVEVAVLGNEEPEAS
VPGEIVSSGEYYDYAAKYIDGKSQMLIPAPVDPEVADRLRESAIAAFRAIEGSGITRADF
FVRKSDGQILINEVNTMPGFTPFSMYPLLWRETGVSYPALLDRMIELALERYKYKQGLKY
DNE
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggggaacacaaaattaaccgtaggactggtgtacggcggcaaatccggagagcatgag
gtatcgctgcagacggcattcgcggttatgaacgcttttgactacgataaatatgagatt
attcctttctatatttccaaacaggggctgtggaaggttggcgaaacactcaccgccgct
tacagcggaattgagcagttgaagcttgccggggcagccggagatatgggcacagcattg
aatgcggtattcagcggactagcgggcggggagaagagcattgatgtgatgttcccgctg
ctgcacggcaccaatggggaagacggtacgattcagggcctgtttgaaatggcgaatatt
ccttatatcggcgcaggcgtgctggcttcatccgcaggtatggataaagtcgtgatgaag
aagctgttcggcgaagcgggtcttgcgcaatgcgagtactgttatttcaacgctgccgta
tggaagcacaaaagccatgagctgattatgggggtagaggataagctgggttaccctgtg
ttcgtcaagccggccaatctgggctccagtgtgggcatttccaaagccgtagataaggaa
agtctaatcaaggctgtcgattttgctttccgctatgataccaaggtcatcattgaagaa
tttgttgatgcccgtgaggtggaggttgctgtacttggcaatgaggaacccgaggcttcc
gttccgggtgaaatcgtctcttccggagaatattatgactatgcggcaaaatatatcgac
ggcaaatcgcagatgctgattccggctcctgtcgaccctgaggtggcggaccgcctgcgt
gaatcggcgattgctgccttccgggcgatcgaaggcagcgggattacccgtgccgacttc
ttcgtacggaaatccgacggccaaattctgattaatgaagtgaatacaatgccgggcttt
acgccgttcagcatgtacccgctgctgtggcgcgagacaggtgtatcgtatcctgctctg
ctggaccgcatgatcgagctggcgctggaacgttacaagtataaacaaggccttaaatac
gacaatgaataa

DBGET integrated database retrieval system