KEGG   Paenibacillus sp. FSL H7-0357: H70357_11230Help
Entry
H70357_11230      CDS       T03358                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
paeh  Paenibacillus sp. FSL H7-0357
Pathway
paeh00020  Citrate cycle (TCA cycle)
paeh00480  Glutathione metabolism
paeh01100  Metabolic pathways
paeh01110  Biosynthesis of secondary metabolites
paeh01120  Microbial metabolism in diverse environments
paeh01130  Biosynthesis of antibiotics
paeh01200  Carbon metabolism
paeh01210  2-Oxocarboxylic acid metabolism
paeh01230  Biosynthesis of amino acids
Module
paeh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paeh_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:paeh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    H70357_11230
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    H70357_11230
Enzymes [BR:paeh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     H70357_11230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIQ17166
UniProt: A0A089HYP9
LinkDB All DBs
Position
2504709..2506004
Genome map
AA seq 431 aa AA seqDB search
MLKLEKYDLPTEGEQITIEDGKLVVPNHPIIPFIEGDGTGRDIWKASKRVLDEAVAKAYG
GTKKIAWYEVFAGEKAFNTYGEWLPNDTLEAIREYIVAIKGPLTTPIGGGIRSLNVALRQ
ELDLYVCLRPVRYFDGVPSPVKHPELVDMVIFRENTEDIYAGIEYQEGSEAVKKVIEFLQ
KEMGVNKIRFPETSGIGIKPVSSEGSKRLVRAAVEYAIKHGRKSVTLVHKGNIMKFTEGA
FKNWGYEVAEQEFGDQVFTWNQYDVIKERDGEAAANAAQKEAEAAGKIIIKDAIADIALQ
QVLTRPTDFDVIATLNLNGDYLSDALAAQIGGIGIAPGANINYLTGHAIFEATHGTAPKY
ADKDVVNPGSVILSGVMLLEHLGWQEAADLIYKGMSTAINNKTVTYDFARQMEGATELKC
SAFADEIINNL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaactagaaaaatacgatctgccgacagaaggcgaacaaatcacgattgaagac
ggcaaactggtggttccgaatcatccgattattccttttattgagggtgacggcactggc
cgcgacatttggaaagcttccaaacgggtgcttgatgaggctgttgccaaagcttacggc
ggtacaaaaaaaattgcctggtatgaagtatttgccggcgaaaaggccttcaatacatat
ggtgaatggctgcctaatgatacgctggaagccattcgtgaatatattgtagctattaaa
ggcccgcttaccactccaatcggcggcggaatccgttctttgaatgtggcgttgcgccag
gaactggacctgtatgtatgtttgcgtccagtgcgttatttcgatggcgtgccttcaccg
gtgaaacatccggagctggtggacatggttattttccgtgagaatacagaagacatttat
gcgggtatcgagtaccaggaaggctccgaggctgtcaagaaagtgattgaattcctgcag
aaggaaatgggtgtgaacaaaatccgcttcccggaaacatccggtatcggcatcaagcca
gtgtcttccgaaggttcgaagcgcctcgtgcgcgctgcagttgaatatgcgatcaagcat
ggacggaagagcgtaacgcttgtgcataagggcaatatcatgaaatttaccgaaggtgcg
tttaagaactggggttacgaagtggctgagcaggagttcggcgaccaagtatttacctgg
aaccaatatgatgtcatcaaggaacgtgatggtgaagctgcggccaacgctgcccagaag
gaagcggaagctgccggcaaaatcatcatcaaggatgccattgccgacatcgctctgcag
caggtattgacccgtccgaccgatttcgacgtgattgctacgctgaacttgaacggtgac
tacttgtccgacgcgcttgctgctcaaatcggcggcatcggcatcgctccgggagcgaac
atcaactatttaacagggcatgctatctttgaagcaacacatggtacggctccgaaatat
gctgataaggacgttgtgaacccgggttcggtcattctttccggagtaatgctgctggag
catttgggctggcaggaagcggctgaccttatctacaaaggaatgagtaccgcgatcaac
aacaaaacggtgacttatgattttgcccgtcaaatggaaggcgcaacagagctgaaatgc
tccgcgtttgctgacgaaattatcaataatctgtag

DBGET integrated database retrieval system