KEGG   Paenibacillus sp. FSL H7-0357: H70357_11230Help
Entry
H70357_11230      CDS       T03358                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
paeh  Paenibacillus sp. FSL H7-0357
Pathway
paeh00480  Glutathione metabolism
paeh01100  Metabolic pathways
paeh01110  Biosynthesis of secondary metabolites
paeh01120  Microbial metabolism in diverse environments
paeh01130  Biosynthesis of antibiotics
paeh01200  Carbon metabolism
paeh01210  2-Oxocarboxylic acid metabolism
paeh01230  Biosynthesis of amino acids
Module
paeh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paeh_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:paeh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    H70357_11230
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    H70357_11230
Enzymes [BR:paeh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     H70357_11230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIQ17166
UniProt: A0A089HYP9
LinkDB All DBs
Position
2504709..2506004
Genome map
AA seq 431 aa AA seqDB search
MLKLEKYDLPTEGEQITIEDGKLVVPNHPIIPFIEGDGTGRDIWKASKRVLDEAVAKAYG
GTKKIAWYEVFAGEKAFNTYGEWLPNDTLEAIREYIVAIKGPLTTPIGGGIRSLNVALRQ
ELDLYVCLRPVRYFDGVPSPVKHPELVDMVIFRENTEDIYAGIEYQEGSEAVKKVIEFLQ
KEMGVNKIRFPETSGIGIKPVSSEGSKRLVRAAVEYAIKHGRKSVTLVHKGNIMKFTEGA
FKNWGYEVAEQEFGDQVFTWNQYDVIKERDGEAAANAAQKEAEAAGKIIIKDAIADIALQ
QVLTRPTDFDVIATLNLNGDYLSDALAAQIGGIGIAPGANINYLTGHAIFEATHGTAPKY
ADKDVVNPGSVILSGVMLLEHLGWQEAADLIYKGMSTAINNKTVTYDFARQMEGATELKC
SAFADEIINNL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaactagaaaaatacgatctgccgacagaaggcgaacaaatcacgattgaagac
ggcaaactggtggttccgaatcatccgattattccttttattgagggtgacggcactggc
cgcgacatttggaaagcttccaaacgggtgcttgatgaggctgttgccaaagcttacggc
ggtacaaaaaaaattgcctggtatgaagtatttgccggcgaaaaggccttcaatacatat
ggtgaatggctgcctaatgatacgctggaagccattcgtgaatatattgtagctattaaa
ggcccgcttaccactccaatcggcggcggaatccgttctttgaatgtggcgttgcgccag
gaactggacctgtatgtatgtttgcgtccagtgcgttatttcgatggcgtgccttcaccg
gtgaaacatccggagctggtggacatggttattttccgtgagaatacagaagacatttat
gcgggtatcgagtaccaggaaggctccgaggctgtcaagaaagtgattgaattcctgcag
aaggaaatgggtgtgaacaaaatccgcttcccggaaacatccggtatcggcatcaagcca
gtgtcttccgaaggttcgaagcgcctcgtgcgcgctgcagttgaatatgcgatcaagcat
ggacggaagagcgtaacgcttgtgcataagggcaatatcatgaaatttaccgaaggtgcg
tttaagaactggggttacgaagtggctgagcaggagttcggcgaccaagtatttacctgg
aaccaatatgatgtcatcaaggaacgtgatggtgaagctgcggccaacgctgcccagaag
gaagcggaagctgccggcaaaatcatcatcaaggatgccattgccgacatcgctctgcag
caggtattgacccgtccgaccgatttcgacgtgattgctacgctgaacttgaacggtgac
tacttgtccgacgcgcttgctgctcaaatcggcggcatcggcatcgctccgggagcgaac
atcaactatttaacagggcatgctatctttgaagcaacacatggtacggctccgaaatat
gctgataaggacgttgtgaacccgggttcggtcattctttccggagtaatgctgctggag
catttgggctggcaggaagcggctgaccttatctacaaaggaatgagtaccgcgatcaac
aacaaaacggtgacttatgattttgcccgtcaaatggaaggcgcaacagagctgaaatgc
tccgcgtttgctgacgaaattatcaataatctgtag

DBGET integrated database retrieval system