KEGG   Paenibacillus sp. FSL H7-0357: H70357_18745Help
Entry
H70357_18745      CDS       T03358                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
paeh  Paenibacillus sp. FSL H7-0357
Pathway
paeh00010  Glycolysis / Gluconeogenesis
paeh00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:paeh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H70357_18745
   00500 Starch and sucrose metabolism
    H70357_18745
Enzymes [BR:paeh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     H70357_18745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AIQ18510
UniProt: A0A089I614
LinkDB All DBs
Position
complement(4153315..4154751)
Genome map
AA seq 478 aa AA seqDB search
MKNLSQTGLSFPEGFLWGGAVAANQLEGAYNEGGKGLSTQDVSPQGAMGAITEEPTEDNM
KLIGIDFYHRYKEDIKLFAEMGFKVFRTSIAWSRIFPYGDETEPNEEGLRFYDSLFDECL
KYGIEPLVTLSHYETPLHLSKQYDGWVNRKLVDFYAQYASTVFKRYKGKVKYWLTFNEIN
SILEVPFMSGGIYTPKEKLSKQDLYQAIHHELVASATAVKLCHEIDPKAQIGCMVLSVPT
YPLTPHPDDIIAVMKYNHSNYFFGDVHVRGRYPGYMKRYFREQGINIHMEPGDEEQLLHT
VDFVSFSYYMSVCQTADPEKNIHGEGNIMGGVANPYLPASEWGWQIDPQGLRFTLNTFYE
RYQKPLFIVENGLGAADELIVNEAGEKTVEDDYRIQYLNDHLFQVAEAVADGVEVMGYTS
WGCIDLVSASSAQLKKRYGYIYVDRHDDGSGTLERYRKKSFHWYKDIIASNGAKLSVK
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatctaagtcaaactggcctgtcattccctgaaggattcttatggggcggcgcc
gtcgccgccaaccagcttgaaggtgcctataatgaaggaggcaaagggctatccactcag
gacgtctcgcctcaaggtgctatgggagcgattaccgaagagcctacagaagataacatg
aagctgatcggcatcgacttttaccaccgttacaaagaagatattaagttgtttgcagag
atgggtttcaaagtgttccggacctccatcgcatggtcgcgtattttcccatatggagac
gaaacagagccaaatgaagagggcttacgcttctacgactctctgtttgacgaatgtttg
aaatatggcattgagcctctggttaccctctcgcattacgaaacaccgctacatctgtcc
aagcagtacgacggttgggtgaaccggaaattagtggatttctacgctcaatatgcaagc
acggtattcaaacgctataaaggcaaagtcaagtactggctgaccttcaacgaaattaac
tcgattctggaagtaccgtttatgagcggaggtatttacacaccaaaagaaaagctcagt
aagcaggatttgtaccaggccattcaccatgaattggttgcgagcgcgaccgcagttaag
ctctgccatgaaatcgatccaaaggcacaaatcggctgtatggtgctgagcgttcctact
tatccgctgacaccgcatccggatgacataattgctgttatgaaatataaccacagcaac
tatttcttcggcgatgtacacgtccgcggacgctacccaggctacatgaagcgttacttc
cgcgagcagggcatcaatattcatatggaaccgggagatgaagagcagttacttcataca
gtcgattttgtgtccttcagttattacatgagtgtctgccaaactgccgatcctgagaaa
aatatacatggcgaaggaaacatcatgggcggcgtggcgaacccctatctccctgcaagc
gaatggggctggcaaattgacccgcagggcctgcgcttcacactgaatacattttatgaa
cgttaccagaaaccactattcatcgtggaaaacgggttaggtgcggcagacgagcttatc
gtaaacgaagccggtgaaaaaacagtcgaagacgactatcgtatccaatacttaaacgat
cacttgtttcaagttgcagaagctgttgccgatggtgtggaagtgatgggttatacgtcg
tggggctgcatagatctcgtcagcgcttcgagcgcacagttgaagaaacggtacggctat
atctatgttgatcgccacgatgacggtagtggaacgctggaacgctaccgcaagaagtca
ttccactggtacaaagacatcattgccagcaacggcgccaagctatcggtgaaataa

DBGET integrated database retrieval system