KEGG   Paenibacillus sp. FSL H7-0357: H70357_25985Help
Entry
H70357_25985      CDS       T03358                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
paeh  Paenibacillus sp. FSL H7-0357
Pathway
paeh00040  Pentose and glucuronate interconversions
paeh00051  Fructose and mannose metabolism
paeh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paeh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    H70357_25985
   00051 Fructose and mannose metabolism
    H70357_25985
Enzymes [BR:paeh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     H70357_25985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C bMG1 AdoHcyase_NAD 2-Hacid_dh_C Pyr_redox Methyltransf_24
Motif
Other DBs
NCBI-ProteinID: AIQ19781
UniProt: A0A089I693
LinkDB All DBs
Position
complement(5652809..5653846)
Genome map
AA seq 345 aa AA seqDB search
MKAAVMDKPGSIVIKEVPVPEVGDHEVLVQVMAVGVCGSDLHYYEHGRIGRFVVEKPIIL
GHECAGVIVAAGEKVTKAVIGDRVAVEPGVTCGHCSACKAGRYNLCPDVQFLATPPVDGA
FVQYLAIREDMVFRIPAHLSFEEAALNEPFSVGIHAAKRSRLQAGETVAIMGMGPVGLMA
VAAAKSHGASRIIVTDLEEVRLEAALRLGATHAINIRKEDAVETIKQLTDGAGVDVAWET
AGNPKALQSALYSIRRGGRLAIVGLPAQDEIPLNVPFIADNEIDIYGIFRYANTYPKGIE
FLASGDVDAGVLITDRYPLAETREALERAIHNKSGSLKVIVYPNE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcggtcatggacaaacccgggagcatcgtaattaaggaagtgccggtaccg
gaggttggcgatcatgaagtgctcgtccaggttatggccgttggcgtatgcggctcggat
ctgcactactatgagcatggccggattgggcggtttgtagtggagaagccgattattctg
gggcatgaatgtgcgggagttattgttgccgcaggagaaaaggtaaccaaagcagtcatc
ggtgaccgtgttgcagttgaaccgggagtgacctgcggacactgcagcgcctgtaaggct
ggaagatacaatctttgccccgatgtccagttccttgcgacacctcctgtagacggagca
ttcgtacagtatctggcgatccgcgaggatatggtgttcaggattcccgctcatttgtct
tttgaagaagcggctttaaatgaacccttctcggtaggcatccacgcggccaaacgaagc
cggctgcaggcaggtgagacggtggcgatcatggggatggggcctgtcgggctgatggcg
gttgcggcagccaaatcccatggggcctcccggatcattgtgaccgatctggaggaggtc
agactggaggcggcgctgcgccttggagcgacgcatgcgatcaatatcaggaaagaggac
gcggtagagaccatcaagcaattaacggatggggcgggcgtagatgtggcctgggagact
gccggtaatccgaaggcgctgcagtcggcactatattccatacggcgcgggggaaggctg
gctatcgtaggtctgccggcacaggatgagataccgcttaatgtgccctttattgcggat
aacgaaatagacatttacggcatcttccgatatgccaatacgtaccccaaaggaatcgaa
tttttggcttcgggagacgtggacgcaggtgtgttaattacagaccgttacccgctggca
gaaacccgcgaagcgctcgaacgggccattcataacaaaagcggcagcctgaaggttatt
gtatatcccaatgaatag

DBGET integrated database retrieval system