KEGG   Paenibacillus sp. FSL H7-0357: H70357_31495Help
Entry
H70357_31495      CDS       T03358                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
paeh  Paenibacillus sp. FSL H7-0357
Pathway
paeh00620  Pyruvate metabolism
paeh00680  Methane metabolism
paeh01100  Metabolic pathways
paeh01120  Microbial metabolism in diverse environments
paeh01200  Carbon metabolism
Module
paeh_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:paeh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    H70357_31495
  09102 Energy metabolism
   00680 Methane metabolism
    H70357_31495
Enzymes [BR:paeh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     H70357_31495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 OTCace Thymidylate_kin
Motif
Other DBs
NCBI-ProteinID: AIQ20703
UniProt: A0A089IDR6
LinkDB All DBs
Position
complement(6873206..6875998)
Genome map
AA seq 930 aa AA seqDB search
MTELTTTVSKSNSNNLLRRDVRFLGNILGEVLVHQGGNELLEIVEKIRETSKSLRSLFLP
ELHNEFKELINSLDPENRHLVIRAFAIYFQLVNIAEQNHRIRRKRDYERSAGETVQPGSI
ESAIQELRERDFSHEDVHEIMNGLSLELVMTAHPTEAMRRAILDIHKRISDDVMGLDNPT
LTFREREQLREKLLNEVITLWQTDELRDRKPTVLDEVRNGMYYFHETIFQVLPDVYQELE
RCLSKYYPGQNWHVPTYLRFGSWIGGDRDGNPSVTAAVTLQTLRLQRKLAIREYQRIMRE
LMQYLSFSTSIVEVTQELVDSIEQDRNIINLNRVDAWRNDNEPYRIKLSYMISKIQNVLD
DEKKGTPERYSSPERFIDDLNVIDRSLRHHYADYVADTYIKKLIRQVELFGFHTATLDVR
QHSQEHENAMTEILAKMNITQDYAKLEENEKIRILENLLNDPRPLTSPYQTYSESTEECL
AVYRTIFTAQEEYGKQCITSYLISMAEAASDILEVMVFAKEVGLFRKDNDGTVVCTLQAV
PLFETIDDLHDAPQIMRTLLSMPIYRDAVSAMSDVQEIMLGYSDSNKDGGVVTANWELRV
ALKQITATAEEFGIKLKFFHGRGGALGRGGMPLNRSILAQPASTIGGGIKITEQGEVISS
RYSMQGIAYRSLEQATSALVTAAINARMPEADLYESKWEEIVARISEVSLNKYQDLIFRD
PDFFAYFKESTPLPEVGELNIGSRPSKRKNSDRFEDLRAIPWVFAWTQSRYLLPAWYAAG
TGLQSFYEDKEENLKIMQHMYENFSFFTTLIDTLQMAIAKADLIIAKEYASMGKNEEARQ
RIFGQIEAEFKLTSELILKITGQQDILDNVPVIQESIRLRNPYVDPLSYLQVQLLSELRA
LREVEGDDAELLREVLLTINGIAAGLRNTG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacttacgactaccgttagcaaaagcaactccaacaatctgctgcggcgggac
gtacggttcctggggaatattctgggcgaagtcttggttcatcaaggcggtaacgaattg
ctggaaatcgtggagaagatccgcgagaccagtaaatcgctgcgctcattgtttttgcct
gaactgcacaatgaatttaaagagctaattaattcactggatccggagaatcgccacctg
gtgatacgggcatttgccatctattttcaattggtgaatatcgccgaacagaatcaccgc
attcgccgaaaacgcgactatgaacgttcagccggggagactgtacagcccgggtccata
gaaagcgctattcaggaactacgcgagcgtgacttctcccatgaggatgtccatgaaatc
atgaatggcctctcactagagctggtcatgacggctcaccctacggaagctatgcgccgg
gcgatccttgatattcataaacggatttccgatgatgtaatgggattggataatcctacc
ttgaccttccgggaacgcgaacagttacgcgagaagctgctgaacgaggtcatcacgttg
tggcagaccgatgagctgcgtgaccgcaagcctacggtactcgatgaagtgcgtaatgga
atgtattatttccatgagacgatttttcaagtattgccggatgtgtaccaagagcttgag
cgatgtctgagcaaatactatccaggccagaactggcatgtaccgacgtatctgcgtttt
ggctcatggatcggcggggaccgcgatggcaacccttcagtgactgctgcggttacgctg
cagacgctgcgcttgcagcgcaagctggctatccgggaatatcagcgtatcatgcgcgaa
ctcatgcagtacctgagttttagtacaagcatcgttgaggtgacgcaggaactggtggat
tccattgaacaggaccgcaacattatcaatcttaaccgggttgatgcctggcgcaatgac
aacgagccgtaccggattaaactaagttacatgatctccaagatacagaacgtgctggat
gatgagaaaaagggtacgcctgagcgctactcctcaccagaacgatttatagatgatttg
aacgtgatagaccgcagtctgcgtcatcactatgcggattatgtagcggatacctacatt
aagaagctgatccgccaggtggagctgtttggcttccacacggctacactggatgttcgc
cagcacagtcaggagcatgaaaatgcgatgacagaaattttggccaaaatgaacatcacg
caggattacgctaaactagaggaaaatgaaaaaattcgaattctggagaatctgctgaat
gatcctcgtccgctgacttcaccttatcagacttacagtgagagcacagaggaatgtctt
gcggtgtaccgtacaatcttcactgcgcaggaggaatacggcaagcaatgcatcaccagt
tatctgatcagtatggctgaagcagcgagcgacatcttagaggttatggtgttcgcgaag
gaagtcggcttgttccgcaaagataatgatggaactgtcgtatgtacactgcaggcagtg
ccgctgtttgagaccattgatgatttacatgatgcgccacaaattatgcgtacactgctt
agtatgccgatctaccgtgatgctgttagtgcgatgagcgatgtgcaggaaattatgctt
ggctattcagacagcaacaaagacggcggggtagttaccgcgaactgggaattgcgcgtt
gcattgaagcaaattacggctactgcagaggaattcgggattaagctgaaattcttccac
ggacgtggtggtgcgctcggacgcggcgggatgccgctgaaccgcagtattcttgctcaa
ccggcctcaaccattggcggtggcatcaagattacggaacagggagaggttatttcttcc
cggtattcgatgcaaggtattgcttaccgcagcttggagcaggcaacctcggcgcttgtg
acggcagctattaatgccagaatgcctgaggctgatctgtacgaaagcaagtgggaagag
attgtggcccggatttccgaagtctcgcttaataaatatcaggatctgatcttccgtgat
ccggatttctttgcttatttcaaagaatcaacaccgctgcccgaggttggagaactcaat
atcggttcccgtccttcgaagcgtaagaatagtgaccgttttgaggatctgcgcgccatt
ccatgggtatttgcgtggacgcagagccgttatctgctcccggcctggtacgccgctgga
acagggctgcagagcttctatgaggataaggaagagaacctgaagatcatgcagcatatg
tatgagaacttctccttctttactacgctcattgacaccctgcaaatggctattgccaag
gccgatctgattatcgccaaggaatacgcaagcatgggtaagaatgaggaagcgcgtcag
cggatattcggccagatcgaagccgaattcaagctgacctcagaactcattctcaaaatt
accggccagcaggatattttggataacgttcctgtgattcaggaatctatccggctgcgc
aatccatacgttgatccactcagctacctgcaggtgcagttgttgtccgagctgagagct
cttcgcgaggttgaaggcgatgacgccgaactgctgcgtgaggtgctgctcacgatcaat
ggtattgccgccggtctgcggaacacgggctga

DBGET integrated database retrieval system