KEGG   Pseudomonas aeruginosa PAO1-VE2: N296_2440
Entry
N296_2440         CDS       T03170                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
paei  Pseudomonas aeruginosa PAO1-VE2
Pathway
paei02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:paei00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    N296_2440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paei02044]
    N296_2440
Secretion system [BR:paei02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   N296_2440
SSDB
Motif
Pfam: VipB VipB_2 TssC
Other DBs
NCBI-ProteinID: AGY64878
LinkDB
Position
2615456..2616940
AA seq 494 aa
MPKSSAAEQSGESSTQTLSLLDEIIAKGRMAHDDSQQDYARDMLAEFATQVLDEGMAVDK
DTVAMINDRISQIDALISDQLNQIIHHPELQKLEASWRGLHQLVSNTETSARLKLRLLNV
GKNELQNDLEKAVEFDQSALFKKIYEEEYGTFGGHPFSLLIGDFTFGRHPQDIGLLEKLS
NVAAAAHAPFIAAASPRLFDMNSFTELAVPRDLTKIFESLELIKWRAFRESEDSRYVSLV
LPNFLLRLPYGPETRPVEGMNYVEDVNGTDHSKYLWGNAAWVLAQRITEAFAKYGWCAAI
RGAEGGGAVEGLPAHTFRTSSGDLSLKCPTEVAITDRREKELNDLGFISLCHKKNSDVAV
FFGGQTTNKARLYNTNEANANARLSAMLPYVLAASRFAHYLKVIMRDKVGSFMTRDNVQT
YLNNWIADYVLINDNAPQEIKAQYPLREARVDVSEVAGKPGAYRATVFLRPHFQLEELSA
SIRLVANLPPPVAA
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgcccaagtcatccgccgccgaacagtccggcgagagttcgacccagaccctgtccctg
ctcgacgagatcatcgccaagggccgcatggcccacgacgacagccagcaggactatgcc
cgcgacatgctcgcggaattcgccacccaggtcctcgacgagggcatggccgtcgacaag
gacaccgtggcgatgatcaacgaccgcatcagccagatcgatgcgctgatcagcgaccag
ctcaaccagatcatccaccaccccgagttgcagaagctggaagcctcctggcgcggcctg
caccaactggtgagcaacaccgagaccagcgcgcggctcaagctgcgcctgctgaacgtc
ggcaagaacgaactgcagaacgacctggagaaggcggtcgagttcgaccagagcgcactg
ttcaagaagatctacgaagaggaatacggcaccttcggcggacaccccttcagcctgctg
atcggcgacttcaccttcggtcgccatccgcaggacatcggcctgctggagaagctgtcg
aacgtcgccgcggctgcccacgcgccgttcatcgccgccgccagcccacgcctgttcgac
atgaacagcttcaccgaactggccgtgccacgcgacctgaccaagatcttcgagagcctg
gagctgatcaagtggcgcgccttccgcgagagcgaggactcgcgctacgtgtcgctggtg
ctgccgaacttcctcttgcgcctgccctacggcccggagacgcgaccggtggaaggcatg
aactatgtcgaggacgtcaacggcaccgaccactccaagtacctctggggcaacgccgcc
tgggtcctggcgcagcgcatcaccgaggccttcgccaagtacggctggtgcgcggcgatc
cgcggcgcggaaggcggcggcgcggtcgagggcctaccggcgcacacgttccgcaccagc
tccggcgacctgtcgctgaagtgcccgaccgaggtggcgatcaccgaccgccgcgagaag
gaactcaacgatctcggcttcatttccctgtgccacaagaagaacagcgacgtggcggtg
ttcttcggcggccagaccaccaacaaggccaggctctacaacaccaacgaggccaacgcc
aacgcgcgcctgtcggcgatgctgccgtacgtgctggcggcatcgcgcttcgcccactac
ctgaaggtgatcatgcgcgacaaggtcggcagcttcatgacccgcgacaacgtgcagacc
tacctgaacaactggatcgccgactacgtgctgatcaacgacaacgcaccgcaggaaatc
aaggcgcagtacccgctgcgcgaggcgcgggtggatgtcagcgaggtggccggcaaaccg
ggagcctaccgcgccacggtgttcctccggccgcacttccagctcgaggaactcagcgcg
tcgatccgcctggtcgccaacctgccgccgccggtagcggcgtga

DBGET integrated database retrieval system