KEGG   Pseudomonas aeruginosa PAO1-VE2: N296_3769Help
Entry
N296_3769         CDS       T03170                                 

Gene name
fabZ
Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
paei  Pseudomonas aeruginosa PAO1-VE2
Pathway
paei00061  Fatty acid biosynthesis
paei00780  Biotin metabolism
paei01100  Metabolic pathways
paei01212  Fatty acid metabolism
Module
paei_M00083  Fatty acid biosynthesis, elongation
paei_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:paei00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    N296_3769 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    N296_3769 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:paei01004]
    N296_3769 (fabZ)
Enzymes [BR:paei01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     N296_3769 (fabZ)
Lipid biosynthesis proteins [BR:paei01004]
 Fatty acid synthase
  Component type
   N296_3769 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas 4HBT_2
Motif
Other DBs
NCBI-ProteinID: AGY63388
LinkDB All DBs
Structure
PDB: 

Position
complement(4082953..4083393)
Genome map
AA seq 146 aa AA seqDB search
MMDINEIREYLPHRYPFLLVDRVVELDIEGKRIRAYKNVSINEPFFNGHFPEHPIMPGVL
IIEAMAQAAGILGFKMLDVKPADGTLYYFVGSDKLRFRQPVLPGDQLQLHAKFISVKRSI
WKFDCHATVDDKPVCSAEIICAERKL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatggacatcaacgagattcgcgaatacctgcctcatcgctatcctttcctgctggtg
gatcgggtggtagagctggacatcgagggcaagcgcattcgcgcctacaagaatgtcagt
atcaatgagccgttcttcaacggacatttccccgagcacccgatcatgccgggcgtgctg
atcatcgaggcgatggcccaggcggccggtatcctcggtttcaagatgctcgacgtgaag
cccgccgacggcaccctttactacttcgtcggttcggacaagctgcgcttccgccagccg
gtcctgccgggcgaccaactgcaactgcacgccaagttcatcagcgtgaagcgcagcatc
tggaaattcgactgccacgctaccgtcgacgacaagccggtatgctcggctgaaatcatc
tgtgcggaacgcaaactatga

DBGET integrated database retrieval system